KEGG   Streptomyces coelicolor: SCO4280Help
Entry
SCO4280           CDS       T00085                                 

Gene name
SCD95A.13c
Definition
(RefSeq) reductase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4694592..4695200)
Genome map
AA seq 202 aa AA seqDB search
MPNTPPLTYPGSLAAPASPLPSPASGHAEGVSNEEFRAAMSRLASGVVLVTAQEPPLDPD
DPLAPRGEDVGMTATAFMSVSLDPPLVLVSLREGSRMDDLLDEQPLWAVSVLSESQRHIA
GRFAMKGRVSDRLLFADIPYARGEATGAPLAGGALATLECRTEQRVPAGDHTLVIGRVLT
ATLPSADGSPLTYFRGRYRQLG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaatactccgcctctcacgtatcccgggtccctcgcggcccccgcgtccccgttg
ccgtcgcccgcctccgggcatgctgagggggtgagcaacgaggagttccgtgccgccatg
tcccggctggcctcgggcgtggtcctggtgaccgcgcaggagccgccgctggacccggac
gacccgctggcgccgcgcggcgaggacgtcgggatgacggccaccgccttcatgtcggtg
tccctggacccgccgctggtcctggtcagcctgcgcgagggctcccgcatggacgacctg
ctggacgaacagcccctgtgggccgtgtcggtcctctccgagagccagcggcacatcgcg
ggccgcttcgcgatgaagggccgcgtcagcgaccgcctcctgttcgcggacatcccgtac
gcgcggggggaggcgaccggggcgcccctggccggcggcgccctggcgaccctggagtgc
cgcaccgaacagcgggtgccggccggcgaccacacgctggtgatcggccgggtcctgacc
gccaccctgccgagcgcggacgggagcccgctgacctacttccggggccggtacaggcag
ctgggctga

DBGET integrated database retrieval system