KEGG   Streptomyces coelicolor: SCO4288Help
Entry
SCO4288           CDS       T00085                                 

Gene name
SCD95A.21
Definition
(RefSeq) phosphatase
  KO
K01087  
trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
sco  Streptomyces coelicolor
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
   00500 Starch and sucrose metabolism
    SCO4288 (SCD95A.21)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     SCO4288 (SCD95A.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
4703578..4704450
Genome map
AA seq 290 aa AA seqDB search
MGSHQDSTRDDSPQPLPTPATAAGREGLDALLADPGRAVVALDFDGTLAPIVPDPDRARA
HPDAVPALAALAPKVASIAVITGRPAEVAVHHGGFADVPGLDRLVVLGHYGAERWDAATG
TLTTPEPHPGVAAVRAELPALLERSGPAARGTWTEDKGHAVAVHTRRAPDPQAAFDALRA
PLTGLASRHGLIVEPGRMVLELRPPGMDKGAALRSYVHSLDAASVLFAGDDLGDLPAYAA
VDVLRTEGTPGLLVCSGSDEVTELRKRADVEVPGPAGVVALLAALAHRLA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccaccaggactccacccgagacgactccccacagcccctgccgacgcccgcg
acggcggccggacgcgaagggctcgacgccctcctcgccgaccccggccgcgcggtggtc
gcgctcgacttcgacggcacgctcgccccgatcgtgcccgaccccgaccgggcccgtgcc
cacccggacgccgtaccggcgctcgcggccctggccccgaaggtcgcctcgatcgcggtg
atcaccgggcgccccgccgaggtcgccgtccaccacggcggcttcgcggacgtccccggc
ctcgaccgcctcgtggtcctcggccactacggtgccgagcgctgggacgccgccaccggc
accctgaccacgccggaaccgcaccccggcgtcgccgccgtccgcgccgagctgccggcc
ctgctggagcggtccggtccggcggcgcggggcacctggacggaggacaagggccacgcg
gtcgccgtccacacccgccgcgcccccgacccgcaggccgccttcgacgccctgcgcgcc
ccgctcaccggcctggcctcccggcacggcctgatcgtcgagccgggccgcatggtcctg
gaactgcgcccacccggcatggacaagggcgcggcgctgcggtcgtacgtccactccctc
gacgccgcctccgtcctcttcgccggcgacgacctcggggacctcccggcctacgcggcc
gtcgacgtcctgcgcaccgagggcactccggggctgctggtctgcagcggcagcgacgag
gtgacggaactgaggaagcgcgcggacgtcgaggtgcccggccccgccggagtggtggcc
ctgctggcggccctcgcgcaccggctggcctga

DBGET integrated database retrieval system