KEGG   Streptomyces coelicolor: SCO4366Help
Entry
SCO4366           CDS       T00085                                 

Gene name
SCD19.21c
Definition
(RefSeq) phosphoserine aminotransferase
  KO
K00831  
phosphoserine aminotransferase [EC:2.6.1.52]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4366 (SCD19.21c)
   01230 Biosynthesis of amino acids
    SCO4366 (SCD19.21c)
  Energy metabolism
   00680 Methane metabolism
    SCO4366 (SCD19.21c)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4366 (SCD19.21c)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCO4366 (SCD19.21c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     SCO4366 (SCD19.21c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class V
   SCO4366 (SCD19.21c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(4778229..4779320)
Genome map
AA seq 363 aa AA seqDB search
MKPADGRFGAGPSKVRVEALDALAATGTSLLGTSHRQAPVKNLVGKVREGIRELFRLPDG
YEVILGNGGSTAFWDVATHGLIENKSQHLSFGEFSSKFAKAAKLAPWLAEPTVVAADPGT
HPEARAEAGVDVYGLTHNETSTGVAMPIRRVAGADEGALVLVDATSGAGGLPVDISETDV
YYFAPQKSFASDGGLWIGVFSPAAIERAERVHASGRHVPEFFSLPTAIDNSRKNQTYNTP
ALATLFLLGEQLDWMNGQGGLDFTTARTKDSSSRLYTWADESKYATPFVSDPTKRSQVIG
TIDFSDDIDAAAVAKVLRANGIVDTEPYRKLGRNQLRVAMFPAIDPADVEALTKCVDHVI
EKL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcggacggtcgtttcggcgcgggtccctccaaggtgcgggtggaggcgctg
gacgccctggccgccaccggtacgtccctgctcggcacctcccaccgccaggcgcccgtc
aagaacctggtcggcaaggtccgtgagggcatccgcgagctgttccggctccccgacggc
tacgaggtgatcctcggcaacggcggctccacggcgttctgggacgtcgcgacccacggc
ctgatcgagaacaagtcgcagcacctgagcttcggcgagttctcctccaagttcgccaag
gccgccaagctcgccccgtggctggccgaaccgaccgtcgtcgccgccgaccccggcacc
caccccgaggcgcgcgccgaggccggcgtggacgtgtacggcctcacgcacaacgagacc
tccaccggtgtcgccatgcccatcaggcgcgtggccggtgccgacgagggcgccctcgtc
ctggtcgacgcgacgtcgggggcgggcggccttccggtcgacatctcggagaccgacgtc
tactacttcgccccgcagaagtccttcgcctccgacggcggcctgtggatcggcgtgttc
tccccggccgcgatcgagcgcgccgagcgcgtgcacgcgtccggccgccatgtcccggag
ttcttctcgctgccgacggcgatcgacaactcccgcaagaaccagacgtacaacaccccg
gcgctggccaccctgttcctcctcggcgagcagctggactggatgaacggccagggcggc
ctggacttcaccacggcccgcaccaaggactcctcgtcccgcctgtacacgtgggccgac
gagtccaagtacgccaccccgttcgtctcggacccgaccaagcgctcgcaggtcatcggc
acgatcgacttctccgacgacatcgacgccgccgccgtcgccaaggtgctgcgcgccaac
ggcatcgtcgacaccgagccgtaccgcaagctcggccgcaaccagctgcgcgtggcgatg
ttcccggcgatcgacccggcggacgtcgaggcgctgacgaagtgcgtggaccacgtcatc
gagaagctgtag

DBGET integrated database retrieval system