KEGG   Streptomyces coelicolor: SCO4381Help
Entry
SCO4381           CDS       T00085                                 

Gene name
SCD10.13
Definition
(RefSeq) acetyl/propionyl CoA carboxylase subunit alpha
  KO
K01965  
propionyl-CoA carboxylase alpha chain [EC:6.4.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4381 (SCD10.13)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4381 (SCD10.13)
   00640 Propanoate metabolism
    SCO4381 (SCD10.13)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4381 (SCD10.13)
Enzymes [BR:sco01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     SCO4381 (SCD10.13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
4796697..4798541
Genome map
AA seq 614 aa AA seqDB search
MITSVLVANRGEIACRVFSTCRESGIRTVAVHSDADANALHARVADAAVRLPGAAPADTY
LRGDLIVKAAVAAGADAVHPGYGFLSENADFARAVRDAGLVWIGPPPEAIEAMASKTRAK
ELMGIAPLTDVTEADLPVLVKAAAGGGGRGMRVVRRLADLDAELTAARAEAASAFGDGEV
FVEPYVVDGRHVEVQILADTHGTVWVLGTRDCSLQRRHQKVIEEAPAPGLTPGLTAELHD
LAVRAARAVDYVGAGTVEFLVADGTAHFLEMNTRLQVEHPVTEAVFGIDLVALQLRIAEG
HALDDDPPRARGHAVEARLYAEDPANGWAPQTGRLHRLAVPDGIRLDTGYTGGDDIGVHY
DPMLAKAVAHAPTRAEAVRRLAGALERAAIHGPVTNRDLLVRSLRHEEFTSGRMDTGFYD
RHLAALTEPAPDPLAPLAAALADASTRAGRFGGWRNLPSQPQVKRYAVAGEEHEVRYGHT
RTGLTAEGVRVVHAGPDRVVLEADGVQRPFDIARYGDHVHVNTTRLTALPRFPDPTTQHA
PGSLLAPMPGTVVRVAEGLTEGTTVQAGQPLLWLEAMKMEHRITAPVTGRLTALPAGLGR
QVEMGALLAVVESD
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacttccgtcctcgtcgccaaccgcggcgagatcgcctgccgcgtcttcagcacc
tgccgcgagtcgggcatccgcaccgtcgccgtgcactcggacgccgacgcgaacgccctc
cacgcgcgcgtggccgacgccgccgtacgcctgccgggcgcggcccccgccgacacctat
ctgcgcggcgacctgatcgtgaaggccgccgtcgccgccggagccgacgccgtccacccc
ggctacggcttcctctccgagaacgccgacttcgcgcgcgccgtacgggacgcggggctg
gtgtggatcggaccgccgcccgaggccatcgaggcgatggcgtccaagacccgcgccaag
gaactgatgggcatcgcgcccctcaccgacgtcaccgaggccgacctgccggtgctggtg
aaggcggcggcgggcggcggcggacgcggcatgcgcgtcgtacgccgcctcgccgacctc
gacgccgaactgaccgccgcccgcgcggaggccgcgagcgccttcggcgacggcgaggtc
ttcgtcgagccgtatgtggtcgacggccgccacgtcgaggtgcagatcctcgccgacacc
cacggcacggtgtgggtgctcggcacccgcgactgctccctccaacgccgccaccagaag
gtgatcgaggaggccccggcgcccggcctgacccccgggctcaccgccgaactccacgac
ctcgccgtgcgcgccgcccgcgccgtcgactacgtcggcgcgggcaccgtcgagttcctc
gtcgccgacggcacggcgcacttcctggagatgaacacccgcctccaggtcgaacacccg
gtcacggaggcggtcttcggcatcgacctcgtcgccctccagctccggatcgccgaaggc
cacgccctcgacgacgaccccccgcgcgcgcgtggccacgccgtcgaggcccgcctctac
gccgaggacccggcgaacggctgggccccgcagaccggccgcctgcaccgcctcgccgtg
ccggacggcatccgcctggacaccggctacaccggcggcgacgacatcggcgtccactac
gacccgatgctcgccaaggcggtcgcccacgcacccacgcgcgcggaggccgtccgccga
ctcgccggcgccctggaacgcgccgcgatccacggcccggtcaccaaccgcgacctcctc
gtccgctccctgcgccacgaggagttcacctccggccgcatggacacgggcttctacgac
cgccacctcgccgccctcaccgagccggcccccgaccccctcgccccgctggccgccgcc
ctcgccgacgcgagcacccgtgcgggacgcttcggcggctggcgcaacctgccctcgcaa
ccgcaggtcaagcggtacgccgtggcgggcgaggaacacgaggtccgttacgggcacacc
cgcacgggcctcaccgccgagggcgtccgcgtcgtccacgcgggccccgaccgggtcgtc
ctcgaagcggacggcgtacaacgccccttcgacatcgcccgctacggcgaccacgtgcac
gtcaacaccacgcgcctcaccgccctgccccgcttccccgaccccaccacccagcacgcc
cccggctccctcctggcccccatgccgggcacggtcgtccgcgtcgcggagggcctgacc
gagggcaccaccgtccaggcgggccagccgttgctgtggctggaggccatgaagatggaa
cacaggatcaccgccccggtgacagggaggctgaccgcactcccggcgggcctcggacga
caagtagagatgggcgccctcttggcggtcgtcgagtccgactga

DBGET integrated database retrieval system