KEGG   Streptomyces coelicolor: SCO4381Help
Entry
SCO4381           CDS       T00085                                 

Gene name
SCD10.13
Definition
(RefSeq) acetyl/propionyl CoA carboxylase subunit alpha
  KO
K01965  
propionyl-CoA carboxylase alpha chain [EC:6.4.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4381 (SCD10.13)
   00640 Propanoate metabolism
    SCO4381 (SCD10.13)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4381 (SCD10.13)
Enzymes [BR:sco01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     SCO4381 (SCD10.13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
4796697..4798541
Genome map
AA seq 614 aa AA seqDB search
MITSVLVANRGEIACRVFSTCRESGIRTVAVHSDADANALHARVADAAVRLPGAAPADTY
LRGDLIVKAAVAAGADAVHPGYGFLSENADFARAVRDAGLVWIGPPPEAIEAMASKTRAK
ELMGIAPLTDVTEADLPVLVKAAAGGGGRGMRVVRRLADLDAELTAARAEAASAFGDGEV
FVEPYVVDGRHVEVQILADTHGTVWVLGTRDCSLQRRHQKVIEEAPAPGLTPGLTAELHD
LAVRAARAVDYVGAGTVEFLVADGTAHFLEMNTRLQVEHPVTEAVFGIDLVALQLRIAEG
HALDDDPPRARGHAVEARLYAEDPANGWAPQTGRLHRLAVPDGIRLDTGYTGGDDIGVHY
DPMLAKAVAHAPTRAEAVRRLAGALERAAIHGPVTNRDLLVRSLRHEEFTSGRMDTGFYD
RHLAALTEPAPDPLAPLAAALADASTRAGRFGGWRNLPSQPQVKRYAVAGEEHEVRYGHT
RTGLTAEGVRVVHAGPDRVVLEADGVQRPFDIARYGDHVHVNTTRLTALPRFPDPTTQHA
PGSLLAPMPGTVVRVAEGLTEGTTVQAGQPLLWLEAMKMEHRITAPVTGRLTALPAGLGR
QVEMGALLAVVESD
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacttccgtcctcgtcgccaaccgcggcgagatcgcctgccgcgtcttcagcacc
tgccgcgagtcgggcatccgcaccgtcgccgtgcactcggacgccgacgcgaacgccctc
cacgcgcgcgtggccgacgccgccgtacgcctgccgggcgcggcccccgccgacacctat
ctgcgcggcgacctgatcgtgaaggccgccgtcgccgccggagccgacgccgtccacccc
ggctacggcttcctctccgagaacgccgacttcgcgcgcgccgtacgggacgcggggctg
gtgtggatcggaccgccgcccgaggccatcgaggcgatggcgtccaagacccgcgccaag
gaactgatgggcatcgcgcccctcaccgacgtcaccgaggccgacctgccggtgctggtg
aaggcggcggcgggcggcggcggacgcggcatgcgcgtcgtacgccgcctcgccgacctc
gacgccgaactgaccgccgcccgcgcggaggccgcgagcgccttcggcgacggcgaggtc
ttcgtcgagccgtatgtggtcgacggccgccacgtcgaggtgcagatcctcgccgacacc
cacggcacggtgtgggtgctcggcacccgcgactgctccctccaacgccgccaccagaag
gtgatcgaggaggccccggcgcccggcctgacccccgggctcaccgccgaactccacgac
ctcgccgtgcgcgccgcccgcgccgtcgactacgtcggcgcgggcaccgtcgagttcctc
gtcgccgacggcacggcgcacttcctggagatgaacacccgcctccaggtcgaacacccg
gtcacggaggcggtcttcggcatcgacctcgtcgccctccagctccggatcgccgaaggc
cacgccctcgacgacgaccccccgcgcgcgcgtggccacgccgtcgaggcccgcctctac
gccgaggacccggcgaacggctgggccccgcagaccggccgcctgcaccgcctcgccgtg
ccggacggcatccgcctggacaccggctacaccggcggcgacgacatcggcgtccactac
gacccgatgctcgccaaggcggtcgcccacgcacccacgcgcgcggaggccgtccgccga
ctcgccggcgccctggaacgcgccgcgatccacggcccggtcaccaaccgcgacctcctc
gtccgctccctgcgccacgaggagttcacctccggccgcatggacacgggcttctacgac
cgccacctcgccgccctcaccgagccggcccccgaccccctcgccccgctggccgccgcc
ctcgccgacgcgagcacccgtgcgggacgcttcggcggctggcgcaacctgccctcgcaa
ccgcaggtcaagcggtacgccgtggcgggcgaggaacacgaggtccgttacgggcacacc
cgcacgggcctcaccgccgagggcgtccgcgtcgtccacgcgggccccgaccgggtcgtc
ctcgaagcggacggcgtacaacgccccttcgacatcgcccgctacggcgaccacgtgcac
gtcaacaccacgcgcctcaccgccctgccccgcttccccgaccccaccacccagcacgcc
cccggctccctcctggcccccatgccgggcacggtcgtccgcgtcgcggagggcctgacc
gagggcaccaccgtccaggcgggccagccgttgctgtggctggaggccatgaagatggaa
cacaggatcaccgccccggtgacagggaggctgaccgcactcccggcgggcctcggacga
caagtagagatgggcgccctcttggcggtcgtcgagtccgactga

DBGET integrated database retrieval system