KEGG   Streptomyces coelicolor: SCO4388Help
Entry
SCO4388           CDS       T00085                                 

Gene name
SCD10.20
Definition
(RefSeq) citrate synthase 2
  KO
K01647  
citrate synthase [EC:2.3.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4388 (SCD10.20)
   01210 2-Oxocarboxylic acid metabolism
    SCO4388 (SCD10.20)
   01230 Biosynthesis of amino acids
    SCO4388 (SCD10.20)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO4388 (SCD10.20)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4388 (SCD10.20)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SCO4388 (SCD10.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
4804464..4805564
Genome map
AA seq 366 aa AA seqDB search
MSDFVPGLEGVVAFETEIAEPDKEGGALRYRGVDIEDLVGHVSFGNVWGLLVDGAFNPGL
PPAEPFPIPVHSGDIRVDVQSALAMLAPAWGLKPLLDIDAAQARDDLARAAVMALSYVAQ
SARGQSLPMVPQREIDKAQSVVERFMIRWRGEPDPKHVAAVDAYWTSAAEHGMNASTFTA
RVIASTGADVAAALSGAVGAMSGPLHGGAPSRVLHMIEEIERTGDAEAYVKKTLDAGERL
MGFGHRVYRAEDPRARVLRRTARELGAPRYEVAEALEKAALAELHARRPDRVLATNVEFW
AAIMLDFAEVPAPMFTSMFTCARTAGWSAHILEQKRTGRLVRPSARYTGPGTRDPREIEG
YADIAG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacttcgtacccgggctagagggagtcgtcgcgttcgagacggagatcgccgaa
cccgacaaggagggcggcgcccttcgctaccgcggcgtcgacatcgaggacctggtcggg
cacgtctccttcggcaacgtctggggcctgctcgtcgacggggccttcaaccccggcctg
ccgcccgccgagcccttccccatccccgtgcactccggcgacatcagggtcgacgtccag
tccgccctcgccatgctcgcccccgcctggggcctcaaacccctgctggacatcgacgcc
gcccaggcccgcgacgacctcgcccgggccgccgtcatggccctgtcctacgtcgcccag
tccgcgcgcggccagagcctgcccatggtcccgcagcgcgagatcgacaaggcccagtcc
gtggtcgaacggttcatgatccgctggcgcggcgagcccgaccccaagcacgtcgccgcc
gtcgacgcctactggacctccgcggccgagcacggcatgaacgcctccaccttcaccgcc
cgcgtcatcgcctccaccggcgcggacgtggccgccgccctctccggggccgtgggcgcc
atgtccggcccgctgcacggcggcgccccctcgcgcgtcctgcacatgatcgaggagatc
gagcgcaccggcgacgccgaggcctacgtcaagaagaccctcgacgcgggcgagcgcctc
atgggcttcggccaccgcgtctaccgcgccgaggacccgcgcgcccgggtcctgcgccgc
accgcccgcgaactgggcgccccgcgctacgaggtcgccgaggccctggagaaggccgcc
ctggccgagctgcacgcccgccgccccgaccgggtgctggccaccaacgtcgagttctgg
gccgccatcatgctggacttcgccgaggtgccggcccccatgttcacctcgatgttcacc
tgcgcccgcaccgcgggctggtccgcgcacatcctggaacagaagcgcaccggccgcctg
gtccgcccctccgcccgctacacggggccgggcacccgcgacccgcgcgagatcgagggc
tacgccgacatcgcgggctga

DBGET integrated database retrieval system