KEGG   Streptomyces coelicolor: SCO4562Help
Entry
SCO4562           CDS       T00085                                 

Gene name
nuoA, SCD16A.21c
Definition
(RefSeq) NADH dehydrogenase subunit A
  KO
K00330  
NADH-quinone oxidoreductase subunit A [EC:1.6.5.3]
Organism
sco  Streptomyces coelicolor
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SCO4562 (nuoA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     SCO4562 (nuoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
4980274..4980633
Genome map
AA seq 119 aa AA seqDB search
MNAYAPILVLGALGAGFAIFSVVMATLIGPKRYNRAKLEAYECGIEPTPTPAGGGRFPIK
YYLTAMLFIIFDIEIVFLYPWAVTFDALGIFGLVEMLLFVLTVFVAYAYVWRRGGLEWD
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgtatgcgcccatcctcgtactgggagccctcggggcaggctttgcgatcttc
tccgtggtgatggccacgctgatcggtccgaagcggtacaaccgggcgaagctcgaggcc
tacgagtgcggcatcgagccgacccccacgccggccggcggcgggcgcttccccatcaag
tactacctgacggcgatgctcttcatcatcttcgatatcgagatcgtcttcctctacccc
tgggccgtcaccttcgacgccctggggattttcgggctcgtggagatgctgctcttcgtg
ctcaccgtcttcgtcgcgtacgcgtacgtatggcggcgcggcggcctggaatgggactga

DBGET integrated database retrieval system