KEGG   Streptomyces coelicolor: SCO4580Help
Entry
SCO4580           CDS       T00085                                 

Gene name
SCD16A.03
Definition
(RefSeq) fumarylacetoacetase
  KO
K01555  
fumarylacetoacetase [EC:3.7.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Tyrosine metabolism
Styrene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCO4580 (SCD16A.03)
  Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SCO4580 (SCD16A.03)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.2  fumarylacetoacetase
     SCO4580 (SCD16A.03)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO4580 (SCD16A.03)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(5000997..5002253)
Genome map
AA seq 418 aa AA seqDB search
MPPFDVPEGDPFGPHNLPYGVFSIPGSLDRTDRTDRTVGVRLGDHVLDAGAAAHALGSPY
AALLAQPTLNPLLAAGRTAWSDVRRALTAWVTVPSHRETLEPFFHPLSSVTLHLPFEVAD
YVDFYASENHARNVGQIFRPDAADSLTPNWKHLPIGYHGRSGTVVVSGTDVVRPSGQRKA
PADAAPVFGPSVRLDIEAEVGFVVGVPSELGSPVALGDFREHVFGLCLLNDWSARDVQAW
EYVPLGPFLGKSFTTSVSAWITPLDALEEARVAPPERTHELLPYLDDTDTDQDAPGGYDL
RISVAVNGHVVSEPPFSTMYWTAAQQLAHMTVNGASLRTGDLYGSGTVSGPTERERGSLL
ELTWNGRDPLELPNGKRTFLEDGDVVTLSAWAPGPDGVRVGLGEVTGRVVGRGVEQGV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccccccttcgatgtccccgagggcgaccccttcggcccgcacaaccttccgtacggc
gtgttctcgatccccggctcgctcgaccggacggaccggacggaccggacggtgggcgtc
cggctgggcgaccacgtcctcgacgcgggggcggcggcccacgcgctcggctcgccgtac
gcggcgctcctcgcgcagcccaccctcaacccgctgctggcggccgggcgcacggcatgg
tcggacgtgcggcgcgcgctgacggcgtgggtgacggtgccctcccaccgcgagaccctg
gagccgttcttccacccgctgtcgtcggtgaccctgcatctgcccttcgaggtcgccgac
tacgtcgacttctacgcctccgagaaccacgcccgcaacgtcggccagatcttccgcccc
gacgccgccgactccctcaccccgaactggaagcacctcccgatcggctaccacggccgc
tccggcacggtcgtcgtctcgggcacggacgtcgtgcgcccgtcggggcagcgcaaggcc
ccggccgacgccgcacccgtcttcggtccgtccgtccggctcgacatcgaggcggaggtc
ggcttcgtcgtgggtgtgccgtccgaactgggcagtccggtcgcgctcggcgacttccgc
gagcacgtcttcgggctctgcctgctcaacgactggtccgcgcgggacgtccaggcctgg
gagtacgtccccctcggtccgttcctcggcaagtccttcaccacgtcggtgtcggcgtgg
atcaccccgctggacgcgctggaggaggcccgggtggcaccgcccgagcgcacgcacgag
ctactgccctacctggacgacacggacaccgaccaggacgcccccggcggctacgacctg
cggatctccgtcgccgtcaacggccacgtcgtctccgagccgccgttctccaccatgtac
tggacggccgcccagcagttggcccacatgacggtcaacggagcctcgctgcgcaccggc
gacctctacggctcgggcacggtgagcgggcccaccgagcgggagcggggttcgctgctc
gaactgacctggaacggccgcgacccgctggaactccccaacggcaagcggacgttcctg
gaggacggcgacgtggtgaccctgtcggcctgggccccgggcccggacggtgtccgggtg
gggctgggagaggtgaccgggcgcgtggtcggccggggggtcgaacagggcgtctga

DBGET integrated database retrieval system