KEGG   Streptomyces coelicolor: SCO4583Help
Entry
SCO4583           CDS       T00085                                 

Gene name
SCD20.01
Definition
(RefSeq) polyprenyl diphosphate synthase
  KO
K00805  
heptaprenyl diphosphate synthase [EC:2.5.1.30]
Organism
sco  Streptomyces coelicolor
Pathway
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO4583 (SCD20.01)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.30  heptaprenyl diphosphate synthase
     SCO4583 (SCD20.01)
Prenyltransferases [BR:sco01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SCO4583 (SCD20.01)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5004917..5005927
Genome map
AA seq 336 aa AA seqDB search
MTVVGPFGLSVRDQALEADVQAGLVAVEEGLLEATKSEVPFITEAAQHLVRAGGKRFRPL
LVMLSAQFGDPYAPGIVPSAVVVELTHLATLYHDDVMDEAAVRRGVPSANTRWDNSVAVL
TGDFLFARASQILADLGPEAVRVQALAFERLVTGQILETAGPQDGRDPVDHYLDVLGGKT
GSLVAVSCRFGAMMSGADETVVDVLTQYGERLGVAFQLADDVLDIASDSDESGKTPGTDL
REGIPTLPVLRLRERAARLGLAEDLALCELLDSDLSDDARHAEALRLLRAHPALEQARRD
TVRYAEEARAALAPLRECDAKAALVELCDAVVHRAG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcgtcgggccgttcgggctgagcgtgcgggaccaggctctggaagccgatgtc
caggccggattggttgctgtcgaggaagggttgcttgaggcaaccaaaagcgaggtgccg
ttcatcacggaggccgcccagcacctggtgcgggccggcgggaaacggttccggccgctg
ctggtgatgctctcggcccagttcggagacccctacgcccccgggatcgtgccctcggcc
gtggtcgtggagctgacccacctggccacgctgtaccacgacgacgtgatggacgaggcc
gccgtgcggcgcggggtgcccagtgcgaacacccgctgggacaactcggtcgcggtcctc
accggcgacttcctgttcgcccgtgcctcccagatcctcgccgacctcggccccgaggcg
gtccgtgtccaggccctcgccttcgaacggctggtcaccggtcagatcctggagacggcc
ggcccgcaggacggccgcgacccggtcgaccactacctggacgtgctgggcggcaagacg
ggctccctggtggcggtctcctgccggttcggcgcgatgatgtccggcgccgacgagacg
gtggtggacgtcctcacccagtacggcgagcggctcggcgtcgccttccagctcgccgac
gacgtcctggacatcgcctccgactccgacgagtccggcaagacgcccggcacggacctg
cgcgagggcatccccaccctgcccgtgctgcggctgcgcgagcgggcggcccggctgggg
ctcgccgaggacctcgcgctgtgcgagctgctcgactccgacctgagcgacgacgcgcgg
cacgccgaggcgctgcgcctgctgcgcgcccacccggcgctggagcaggcccgccgggac
accgtccggtacgcggaggaggcccgggcggcgctcgccccgctgcgcgaatgcgacgcg
aaggccgcgctggtggagctgtgcgacgcggtggtccaccgggccggctga

DBGET integrated database retrieval system