KEGG   Streptomyces coelicolor: SCO4594Help
Entry
SCO4594           CDS       T00085                                 

Gene name
SCD20.12c
Definition
(RefSeq) 2-oxoglutarate ferredoxin oxidoreductase subunit beta
  KO
K00175  
2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO4594 (SCD20.12c)
   00020 Citrate cycle (TCA cycle)
    SCO4594 (SCD20.12c)
   00620 Pyruvate metabolism
    SCO4594 (SCD20.12c)
   00650 Butanoate metabolism
    SCO4594 (SCD20.12c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     SCO4594 (SCD20.12c)
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     SCO4594 (SCD20.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5016376..5017434)
Genome map
AA seq 352 aa AA seqDB search
MPDAGALLPLVPKAGGKQSMKDFKSDQEVRWCPGCGDYAILAAVQGFMPQLGLARENIVF
VSGIGCSSRFPYYMNTYGMHSIHGRAPAIATGLATSRRDLSVWVVTGDGDALSIGGNHLI
HALRRNVNLKILLFNNRIYGLTKGQYSPTSEVGKITKSTPMGSLDAPFNPISLALGAEAS
FVARTVDSDRKHLTEVLRQAAEHPGTALIEIYQNCNIFNDGAFDALKDKQQAEEAVIRLE
HGQPIRFGTDNTKGVLRNPHTGDLDIVTVTADNEADILVHDAHATSPTTAFALSRLADPD
TLHHTPIGVLRSVERPVYDTLMSEQLDTAVETDGKGDLAALLAGNDTWTVVG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgcgggcgcactgctccccctcgtccccaaggccgggggcaagcagtccatg
aaggacttcaagtccgaccaggaagtgcgctggtgccccggctgcggcgactacgccatc
ctcgccgccgtgcagggcttcatgccccagctcggcctcgcccgcgagaacatcgtcttc
gtctccggcatcggctgctcctcccgcttcccgtactacatgaacacctacgggatgcac
tccatccacggccgcgcccccgccatcgccaccggcctcgccacctcccgccgcgacctg
tcggtgtgggtcgtcaccggggacggcgacgcgctctccatcggcggcaaccacctcatc
cacgccctgcgccgcaacgtcaacctcaagatcctgctgttcaacaaccggatctacggc
ctcaccaaaggccagtactcccccacctccgaggtcgggaagatcaccaagtcgacaccg
atgggctccctcgacgcgcccttcaaccccatctccctggccctcggcgcggaggcgtcc
ttcgtcgcccggaccgtcgactccgaccgcaaacacctcaccgaggtactgcgccaggcc
gccgaacaccccggcaccgccctgatcgagatctaccagaactgcaacatcttcaacgac
ggcgccttcgacgccctcaaggacaaacagcaggccgaagaagcagtgatccgcctggaa
cacgggcagccgatccgtttcggcaccgacaacaccaagggcgtcctacgcaacccgcac
accggagacctggacatcgtcaccgtcaccgcggacaacgaagcagacatcctcgtccac
gacgcccacgccacctcccccaccacggccttcgcactctcccgcctcgccgaccccgac
accctgcaccacacccccatcggcgtcctgcgctccgtcgaacgccccgtctacgacacc
ctcatgtccgaacagctcgacaccgccgtcgaaacagacggcaagggcgacctcgccgcg
ttgctggccggcaacgacacctggacggtcgtcggctga

DBGET integrated database retrieval system