KEGG   Streptomyces coelicolor: SCO4643Help
Entry
SCO4643           CDS       T00085                                 

Gene name
murB
Definition
(RefSeq) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  
UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
sco  Streptomyces coelicolor
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO4643 (murB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCO4643 (murB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     SCO4643 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:sco01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   SCO4643 (murB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5067001..5068152
Genome map
AA seq 383 aa AA seqDB search
MRTRRDVPADRSGRSRVSRHPGLSVPSRTLEPVQELHDAPLAPLTTFRLGGPATRLLTAT
TDAEVIAAVREADDTGTPLLLIGGGSNLVIGDKGFDGTALHIATRGFRLDGTTLELAAGE
IWTDAVARTVEAGLAGVECLAGIPGSAGATPIQNVGAYGQEVSATITEVTAYDRRSGETV
ALSNADCAFSYRHSRFKAEPERYVVLRVRFELENADGLSAPLRYAETARALGVEAGDRVP
LTAARETVLRLRAGKGMVLDPEDHDTWSAGSFFTNPILTDEEFAAFRSRVAGRLGAAVEP
PAFPAGEGRVKTSAAWLIDKAGFTKGYGTGPARISTKHTLALTNRGEATTEDLLALAREV
VAGVHEAFGVTLVNEPVTVGVAL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacacgccgcgacgtcccggccgaccggtcggggcgttcccgcgtttcccgccac
cccggactgtcggtgccgtctcgtactcttgagcccgtgcaggaactccacgacgccccc
ctcgccccgctgaccaccttccgcctgggcgggcccgcgacccggctgctcacggccacc
accgacgccgaggtgatcgccgccgtccgcgaggccgacgacaccgggaccccgctgctg
ctcatcggcggcggatccaacctcgtcatcggcgacaagggcttcgacggcaccgccctg
cacatcgccacgcgcggcttccgcctcgacggcacgacgctggagctggcggccggcgag
atctggaccgacgcggtcgcccgcaccgtcgaggcgggcctggcgggcgtcgagtgcctg
gccggcatccccggctcggcgggcgcgaccccgatccagaacgtcggcgcgtacggccag
gaggtgtccgccacgatcaccgaggtcacggcgtacgaccgccggagcggcgagacggtc
gccctctccaacgcggactgcgccttctcctaccgccacagccgcttcaaggccgagccc
gagcggtacgtggtcctgcgggtccgcttcgagctggagaacgccgacgggctctccgcg
cccctccggtacgccgagacggcccgcgccctcggtgtcgaggcgggcgaccgggtgccg
ctgacggccgcccgggagacggtgctgaggctgcgtgccgggaagggcatggtgctggac
ccggaggaccacgacacgtggtcggccgggtcgttcttcaccaacccgatcctcacggac
gaggagttcgccgcgttccgctcccgcgtcgccggacgcctcggtgccgccgtggagccg
cccgccttcccggccggggagggccgggtcaagacctccgcggcctggctgatcgacaag
gcgggcttcaccaaggggtacggcacgggccccgcgcgcatctccaccaagcacaccctc
gcgctcaccaaccgcggcgaggcgacgaccgaggacctgctcgcgctggcccgcgaggtc
gtcgccggggtccacgaggccttcggcgtcacgctggtcaacgaaccggtgacggtgggc
gtcgccctgtag

DBGET integrated database retrieval system