KEGG   Streptomyces coelicolor: SCO4645Help
Entry
SCO4645           CDS       T00085                                 

Gene name
aspC, SCD82.16c
Definition
(RefSeq) aspartate aminotransferase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5069749..5070975)
Genome map
AA seq 408 aa AA seqDB search
MSAAIPPTERRVSARVGAISESATLAVDAKAKALKAAGRPVIGFGAGEPDFPTPDYIVEA
AVEACKNPKFHRYTPAGGLPELKAAIAAKTLRDSGYEVDPSQILVTNGGKQAIYEAFAAI
LDPGDEVIVPAPYWTTYPESIRLAGGVPVEVVADETTGYRVTVEQLEAARTEKTKVVLFV
SPSNPTGAVYGEAETEAIGRWAVEHGLWVLTDEIYEHLVYGDAVSVSLPALLPELRDKCI
VVNGVAKTYAMTGWRVGWVIGPKDVVKAATNLQSHATSNVANVSQAAALAAVSGNLDAVA
KMREAFDRRRQTIVRMLNEIDGVLCPEPEGAFYAYPSVKALLGKEIRGKRPQDSVELAAL
ILEEAEVAVVPGEAFGTPGYLRLSYALGDEDLVEGVSRIQKLLAEARD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcaatccctcccaccgagcgccgggtctccgcccgagtcggcgcgatctcc
gagtccgcgaccctcgccgtggacgccaaggccaaggccctcaaggccgccggacgtccc
gtgatcggcttcggcgcgggtgagcccgacttcccgacgccggactacatcgtcgaggcc
gccgtcgaggcgtgcaagaacccgaagttccaccgctacacgccggccggcgggctgccc
gagctgaaggccgccatcgccgcgaagacgctgcgcgactccggctacgaggtcgacccg
tcgcagatcctcgtcaccaacggcggcaagcaggccatctacgaggcgttcgccgcgatc
ctcgacccgggcgacgaggtcatcgtcccggcgccgtactggacgacgtacccggagtcg
atccggctggccggcggtgtgcccgtcgaggtcgtcgccgacgagacgaccggctaccgg
gtgacggtggagcagctggaggcggcgcgcaccgagaagaccaaggtcgtcctgttcgtg
tcgccgtcgaacccgacgggggcggtgtacggcgaggccgagaccgaggccatcggccgc
tgggccgtcgagcacgggctgtgggtgctgaccgacgagatctacgagcacctggtgtac
ggcgacgccgtctccgtgtccctgccggcgctgctgcccgagctgcgcgacaagtgcatc
gtggtcaacggcgtggcgaagacgtacgcgatgaccggctggcgggtcgggtgggtcatc
gggccgaaggacgtcgtcaaggccgcgaccaacctccagtcgcacgccacgtccaacgtg
gccaacgtgtcgcaggcggcggcgctggccgcggtctccggcaacctggacgccgtggcg
aagatgcgggaggccttcgaccggcgccgccagacgatcgtgcggatgctgaacgagatc
gacggcgtgctctgcccggagcccgagggcgcgttctacgcctacccgtcggtgaaggcg
ctgctcggcaaggagatccgcggcaagcgtccgcaggactcggtcgagctggccgcgctc
atcctggaggaggccgaggtcgcggtggtgcccggtgaggcgttcggcacgccggggtac
ctgcggctgtcgtacgcgctcggggacgaggacctcgtcgagggcgtgagccggatccag
aagctgctggcggaggcgcgggactga

DBGET integrated database retrieval system