KEGG   Streptomyces coelicolor: SCO4683Help
Entry
SCO4683           CDS       T00085                                 

Gene name
gdhA, SCD31.08
Definition
(RefSeq) glutamate dehydrogenase
  KO
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SCO4683 (gdhA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO4683 (gdhA)
   00220 Arginine biosynthesis
    SCO4683 (gdhA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     SCO4683 (gdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5112014..5113399
Genome map
AA seq 461 aa AA seqDB search
MPAVPERAPVTTRSETQSTLDHLLTEIELRNPAQPEFHQAAHEVLETLAPVVAARPEYAE
PGLIERLVEPERQVMFRVPWQDDQGRVRVNRGFRVEFNSALGPYKGGLRFHPSVNLGVIK
FLGFEQIFKNALTGLGIGGGKGGSDFDPHGRSDAEVMRFCQSFMTELYRHIGEHTDVPAG
DIGVGGREIGYLFGQYRRITNRWESGVLTGKGQGWGGSLIRPEATGYGNVLFAAAMLRER
GEDLEGQTAVVSGSGNVAIYTIEKLTALGANAVTCSDSSGYVVDEKGIDLDLLKQIKEVE
RGRVDAYAERRGASARFVPGGSVWDVPADLALPSATQNELDENAAATLVRNGVKAVSEGA
NMPTTPEAVHLLQKAGVAFGPGKAANAGGVAVSALEMAQNHARTSWTAARVEEELADIMT
SIHTTCHETAERYDAPGDYVTGANIAGFERVADAMLAQGVI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgtgccagaaagggcccctgtgacgacgcgaagcgagacgcagtccaccctc
gaccacctcctcaccgagatcgagctgcgcaacccggcccagcccgagttccaccaggcg
gcccacgaggtcctggagaccctggcgccggtcgtcgcggcccgccccgagtacgccgag
ccgggcctcatcgagcggctggtcgagccggagcgccaggtgatgttccgggtgccgtgg
caggacgaccagggccgcgtccgcgtcaaccggggcttccgggtcgagttcaacagcgcg
ctgggcccgtacaagggcggtctgcgcttccatccgtccgtcaacctgggcgtcatcaag
ttcctgggcttcgagcagatcttcaagaacgcgctgaccggcctcggcatcggcggcggc
aagggcggcagcgacttcgacccgcacgggcgcagcgacgcggaggtcatgcggttctgc
cagtccttcatgacggagctgtaccggcacatcggcgagcacacggacgtcccggcgggg
gacatcggcgtcgggggccgcgagatcggctacctcttcggccagtaccggcggatcacc
aaccgctgggagtccggcgtcctgaccggcaagggccagggctggggcggctcgctgatc
cgcccggaggcgaccggctacggcaacgtgctgttcgcggcggcgatgctgcgggagcgc
ggcgaggacctggagggccagaccgcggtcgtctccggctccggcaacgtggcgatctac
accatcgagaagctgaccgccctcggcgccaacgccgtcacctgctcggactcctccggc
tacgtcgtcgacgagaagggcatcgacctcgacctgctcaagcagatcaaggaggtcgag
cgcggccgcgtcgacgcgtacgccgagcgccggggcgcctcggcccgcttcgtgcccggc
ggcagcgtctgggacgttccggccgaccttgccctcccctccgccacgcagaacgagctg
gacgagaacgccgccgccacgctcgtccgcaacggcgtcaaggcggtctccgagggcgcg
aacatgccgaccacccccgaggccgtccacctgctccagaaggcgggcgtcgccttcggc
cccggcaaggcggccaacgcgggcggcgtcgcggtcagcgccctggagatggcgcagaac
cacgcccgtacctcgtggacggcggcgcgggtcgaggaggagctggccgacatcatgacc
agcatccacaccacctgccacgagaccgccgagcgctacgacgcccccggcgactacgtc
accggcgcgaacatcgccggcttcgagcgggtggccgacgcgatgctggcgcagggcgtc
atctga

DBGET integrated database retrieval system