KEGG   Streptomyces coelicolor: SCO4729Help
Entry
SCO4729           CDS       T00085                                 

Gene name
rpoA, SC6G4.07
Definition
(RefSeq) DNA-directed RNA polymerase subunit alpha
  KO
K03040  
DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4729 (rpoA)
   00240 Pyrimidine metabolism
    SCO4729 (rpoA)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    SCO4729 (rpoA)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     SCO4729 (rpoA)
Transcription machinery [BR:sco03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     SCO4729 (rpoA)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      SCO4729 (rpoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5142327..5143349
Genome map
AA seq 340 aa AA seqDB search
MLIAQRPSLTEEVVDEFRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVL
HEFTTVPGVKEDVTDLILNIKQLVVSSEHDEPVVMYLRKQGPGLVTAADIAPPAGVEVHN
PDLVLATLNGKGKLEMELTVERGRGYVSAVQNKQVGQEIGRIPVDSIYSPVLKVTYKVEA
TRVEQRTDFDKLIVDVETKQAMRPRDAMASAGKTLVELFGLARELNIDAEGIDMGPSPTD
AALAADLALPIEELELTVRSYNCLKREGIHSVGELVARSEADLLDIRNFGAKSIDEVKAK
LAGMGLALKDSPPGFDPTAAADAFGADDDADAGFVETEQY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgctcagcgtccctcgttgaccgaagaggtcgtcgacgagttccgctcccgg
ttcgtcatcgagccgctggagccgggcttcggctacaccctcggcaactccctgcgccgg
accctcctgtcgtcgatcccgggtgcggcggtcacgtccatccgtatcgacggtgtcctg
cacgagttcaccaccgtgccgggcgtcaaggaggacgtcaccgacctgatcctcaacatc
aagcagctggtcgtctcctcggagcacgacgagccggtcgtgatgtacctgcgcaagcag
ggcccgggtctggtcaccgccgccgacatcgcgcccccggccggtgtcgaggtgcacaac
cccgacctcgtcctcgccacgctcaacggcaagggcaagctggagatggagctgaccgtc
gagcgcggtcgcggctacgtctccgccgtgcagaacaagcaggtcggtcaggagatcggg
cgcatcccggtcgactcgatctactcgccggttctcaaggtcacgtacaaggtcgaggcc
acgcgtgtcgagcagcgcaccgacttcgacaagctgatcgtcgacgtcgagaccaagcag
gccatgcgtccgcgcgacgccatggcgtcggccggcaagaccctggtcgagctgttcggt
ctcgcccgcgagctgaacatcgacgccgagggcatcgacatgggtccgtccccgacggac
gccgcgctggctgcggacctggctcttccgatcgaggagctggagctcaccgtccggtcg
tacaactgcctcaagcgcgagggcatccactccgtgggtgagctggtcgctcgctccgag
gcggacctgctcgacatccgcaacttcggtgcgaagtccatcgacgaggtcaaggccaag
ctggccggcatgggcctggccctcaaggacagcccgcccggattcgacccgaccgccgcc
gcggacgcgttcggtgccgatgacgatgctgacgccggtttcgtggagaccgagcagtac
tga

DBGET integrated database retrieval system