KEGG   Streptomyces coelicolor: SCO4736Help
Entry
SCO4736           CDS       T00085                                 

Gene name
glmM
Definition
(RefSeq) phosphoglucosamine mutase
  KO
K03431  
phosphoglucosamine mutase [EC:5.4.2.10]
Organism
sco  Streptomyces coelicolor
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO4736 (glmM)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.10  phosphoglucosamine mutase
     SCO4736 (glmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5148674..5150032
Genome map
AA seq 452 aa AA seqDB search
MGRLFGTDGVRGVANADLTAELALGLSVAAAHVLAEAGTFAGHRATAVVGRDPRASGEFL
EAAVVAGLASAGVDVLRVGVLPTPAVAHLTGALGADLGVMLSASHNAMPDNGIKFFARGG
HKLADELEDRIESVYADHRTGAPWDRPTGSGVGRVRDYDEGLDQYVAHLVGVLPNRLDGL
KIVLDEAHGAASRVSPEAFARAGAELVTIGAVPDGLNINDGCGSTHLDLLKAAVVEHGAD
LGIAHDGDADRCLAVDHTGAEVDGDQILAVLALAMREREALRSDTVVATVMSNLGFKLAM
EREGIRFVQTGVGDRYVLEEMKEHGYALGGEQSGHVIILDHATTGDGTLTGLMLAARVAQ
TGRTLRDLASVMERLPQVLVNVPDVDKSRVTSSAELATAVAEAERELGSTGRVLLRPSGT
EPLVRVMVEAADIEQARSVAGRLADSVKSALG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgggacgactcttcggcacggacggcgtgcgcggcgtcgccaacgcggatctgacggcc
gagctggcgctgggcctctccgtcgccgcggcgcacgtactggccgaggcgggcaccttc
gccgggcaccgggcgaccgcggtggtcggccgggacccacgtgcctccggggagttcctg
gaggccgcggtggtcgcgggcctcgccagcgccggtgtggacgtgctgcgggtcggcgtc
ctgccgacgcccgcggtggcccacctcaccggcgcgctcggcgccgacctcggcgtgatg
ctgtccgccagccacaacgccatgcccgacaacggcatcaagttcttcgcccgcggcggc
cacaagctcgccgacgagctggaggaccgcatcgagtccgtctacgccgaccaccgcacc
ggcgccccctgggaccgcccgaccggctccggcgtcggccgcgtccgggactacgacgag
gggctcgaccagtacgtcgcccacctcgtcggtgtcctcccgaaccgtctcgacggactg
aagatcgtcctcgacgaggcgcacggcgcggcctcccgggtctcgccggaggcgttcgcg
cgggccggtgccgaactggtcaccatcggcgcggtgcccgacggcctcaacatcaacgac
ggctgcggctccacccacctcgacctgctcaaggccgccgtcgtcgagcacggcgccgac
ctgggcatcgcccacgacggcgacgcggaccgctgcctggccgtggaccacaccggtgcg
gaggtcgacggcgaccagatcctcgccgtgctcgcgctcgcgatgcgggagcgggaggcg
ctgcgctcggacaccgtcgtcgcgaccgtcatgtccaacctgggcttcaagctcgccatg
gagcgcgagggcatccggttcgtgcagaccggggtcggcgaccggtacgtcctggaggag
atgaaggagcacggctacgccctcggcggcgagcagtccggccacgtcatcatcctcgac
cacgccaccacgggtgacggcacgctgaccggcctgatgctggcggcgcgggtcgcgcag
accgggcgtacgctgcgggacctcgcgtccgtgatggagcggctgccgcaggtgctggtc
aatgtgccggacgtggacaagtcgcgggtgacgagctccgccgagctggcgaccgccgtg
gccgaggccgagcgggagttggggagcaccgggcgggtgctgctgcgtccctcggggacc
gagccgctggtgcgggtgatggtggaggccgcggacatcgagcaggcccggtccgtggcg
gggcggttggccgattcggtgaagtccgcgctcggttag

DBGET integrated database retrieval system