KEGG   Streptomyces coelicolor: SCO4740Help
Entry
SCO4740           CDS       T00085                                 

Gene name
glmS1, SC6G4.18
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO4740 (glmS1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO4740 (glmS1)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     SCO4740 (glmS1)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C44
   SCO4740 (glmS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5153334..5155181
Genome map
AA seq 615 aa AA seqDB search
MCGIVGYVGPQSALDVVMAGLKRLEYRGYDSAGVAVLADGGLATAKRAGKLVNLDKELSE
HPLPAAATGIGHTRWATHGGPTDANAHPHLDNAGRVAVVHNGIIENFAPLRAELAERGHE
LPSETDTEVVAHLLAEEYSACADLAEAMRLVCGRLEGAFTLVAVHADAPDVVVGARRNSP
LVVGVGEGEYFLASDVAAFIAHTRDAVELGQDQVVELRRDGVRVTGFDGSPADVRSYHVD
WDASAAEKCGYASFMLKEIAEQPKAVADTLLGRIDGSGTLSLDEVRIPPGVLREVDKVVV
VACGTAFHAGLIAKYAIEHWTRIPCEVELASEFRYRDPILDQQTLVVAISQSGETMDTLM
ALRHAREQGARVLAICNTNGSTIPRESDAVLYTHAGPEVAVASTKAFLTQLVACYLVALY
LGQVRGTKYGDEIGDVVRDLSGISGAVERVLGTMDPVRQLARSLAHKNTVLFLGRHVGHP
VALEGALKLKELAYMHAEGFAAGELKHGPIALIEEDLPVVVVVPSPRGRSVLHDKIVSNI
QEIRARGARTIVIAEEGDEAVVPYADHLVRIPATPTLLQPLVATVPLQVFACELATARGN
EVDQPRNLAKSVTVE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtgggatacgtagggcctcagtcggcactcgatgtcgtgatggccgga
ctgaagcggctcgaataccggggatacgactcggcgggcgtcgccgtgctcgcggacggc
ggcctcgccaccgccaagcgggccggcaagctcgtcaatctcgacaaggaactgtccgaa
cacccgctgccggccgccgccaccggcatcggccacacccgctgggccacccacggcggc
cccaccgacgccaacgcccacccgcacctcgacaacgcgggccgggtggccgtcgtccac
aacggcatcatcgagaacttcgcgccgctgcgggccgagctggcggagcgcggccacgaa
ctgccctccgagaccgacaccgaggtcgtcgcccacctgctcgccgaggagtactcggcc
tgcgccgacctcgccgaggcgatgcggctggtgtgcggccgcctggagggcgcgttcacc
ctggtcgcggtgcacgcggacgcgccggacgtggtggtgggcgcgcgccgcaactcgccg
ctcgtggtgggggtgggggagggcgagtacttcctcgcctcggacgtcgcggccttcatc
gcccacacccgggacgccgtcgagctgggccaggaccaggtcgtcgaactgcgccgggac
ggcgtgcgggtcaccggcttcgacggctccccggcggacgtccgctcctaccacgtcgac
tgggacgcctcggccgccgagaagtgcggctacgcctccttcatgctcaaggagatcgcc
gagcagccgaaggccgtcgccgacaccctcctcggccgcatcgacggctccggcacgctg
agcctggacgaggtgcgcatcccgccgggggtgctccgggaggtcgacaaggtcgtcgtc
gtcgcctgcggtacggccttccacgccgggctgatcgccaagtacgccatcgagcactgg
acgcggatcccctgcgaggtggagctggccagcgagttccgctaccgcgacccgatcctc
gaccagcagaccctggtcgtcgcgatctcccagtccggcgagaccatggacaccctcatg
gccctgcgccacgcccgtgaacagggcgccagggtcctcgcgatctgcaacaccaacggc
tcgaccatcccccgcgagtccgacgccgtgctctacacccacgcgggccccgaggtcgcc
gtcgcctccaccaaggccttcctcacccagctcgtggcctgctacctggtcgccctctac
ctgggccaggtgcgcggcacgaagtacggcgacgagatcggcgacgtcgtccgcgacctg
tccggcatctccggcgcggtcgaacgggtcctggggaccatggacccggtgcgccaactg
gcccgctccctcgcccacaagaacacggtgctcttcctcggccggcacgtcggccacccc
gtcgccctcgaaggcgccctcaagctcaaggagctggcgtacatgcacgccgagggcttc
gcggcgggcgagctgaagcacgggccgatcgcgctgatcgaggaggacctgccggtcgtg
gtggtggtgccgtccccgcgcggccgctcggtgctgcacgacaagatcgtgtccaacatc
caggagatccgcgcccgcggcgcccgcaccatcgtcatcgccgaggagggcgacgaggcg
gtcgtcccctacgccgaccacctcgtccggatcccggccaccccgacgctgctgcaaccc
ctggtggccacggtgccgttgcaggtcttcgcctgcgaactggccacggcccgcggcaac
gaggtcgaccagccgcggaacctggcgaagtcggtgacggtggagtag

DBGET integrated database retrieval system