KEGG   Streptomyces coelicolor: SCO4745Help
Entry
SCO4745           CDS       T00085                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCO4745 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SCO4745 (alr)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SCO4745 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sco01011]
 Precursor biosynthesis
  Racemase
   SCO4745 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
5158508..5159683
Genome map
AA seq 391 aa AA seqDB search
MSETTARRDADAVLRARAEIDLAALRANVRALRERAPGAALMAVVKADAYGHGAIPCARA
AVAAGATWLGTATPQEALALRAAEPGLPDDVRIMCWLWTPGGPWREAVEARLDVSVSAMW
AMEEVTGAARAAGVPARVQLKADTGLGRGGCQPGADWERLVGAALRAEEEGLLRVTGLWS
HFACADEPGHPSIAAQLTRFREMTAYAEQRGLRPEVRHIANSPATLTLPDAHFDLVRPGI
AMYGVSPSPEIGTPADFGLRPVMTLAASLALVKQVPGGHGVSYGHHYTTPGETTLGLVPL
GYADGIPRHASSSGPVLVDGKWRTVAGRIAMDQFVVDLGGDRPEPGAEAVLFGPGDRGEP
TAEDWAQAAGTIAYEIVTRIGSRVPRVYVNE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacaactgctcggcgggacgcggacgcggtactgcgcgcccgggccgagatc
gacctggccgccctgcgggccaacgtacgcgcactgcgcgaacgggcccccggggcggct
ctcatggccgtcgtcaaggcggacgcctacggccacggcgcgatcccctgcgcccgtgcg
gccgtcgcggccggtgcgacctggctcggcaccgccaccccgcaggaggccctcgccctg
cgcgcggcggagccaggcctgccggacgacgtacggatcatgtgctggctgtggacgccc
ggcgggccctggcgggaggcggtcgaggcccgtctcgacgtgtccgtcagcgcgatgtgg
gccatggaggaggtcaccggggcggcccgggcggccggggtgcccgcgcgcgtgcagctc
aaggccgacaccggcctcgggcggggcggctgccagcccggcgcggactgggagcggctg
gtcggggccgcgctgcgggccgaggaggaggggctgctgagagtcaccgggctctggtcc
cacttcgcctgcgccgacgagcccggccacccctccatcgccgcccagctcacccgtttc
cgggagatgacggcctacgccgagcagcggggcctgcgtcccgaggtgcggcacatcgcc
aactcgccggccaccctcaccctccccgacgcccacttcgacctcgtccggcccggcatc
gcgatgtacggtgtctcaccgagccccgagatcggcaccccggccgacttcgggctgcgc
cccgtgatgacgctggccgcctcgctggccctggtcaagcaggtccccggcggccacggc
gtcagctacgggcaccactacaccacccccggcgagaccaccctcggcctcgtcccgctc
ggctacgcggacggcatcccccggcacgcctcctccagcggccccgtgctggtcgacggc
aagtggcgcacggtcgcggggcggatcgcgatggaccagttcgtcgtcgacctgggcggg
gaccggcccgagccgggcgccgaggcggtgctgttcggaccgggcgaccgcggcgagccc
accgccgaggactgggcccaggcggcgggcaccatcgcgtacgagatcgtcacccggatc
ggaagccgggtcccgcgcgtctacgtcaacgaatga

DBGET integrated database retrieval system