KEGG   Streptomyces coelicolor: SCO4770Help
Entry
SCO4770           CDS       T00085                                 

Gene name
guaB, SCD63.02
Definition
(RefSeq) inosine 5' monophosphate dehydrogenase
  KO
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4770 (guaB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     SCO4770 (guaB)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SCO4770 (guaB)
  Exosomal proteins of breast cancer cells
   SCO4770 (guaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5181347..5182852
Genome map
AA seq 501 aa AA seqDB search
MTANVDGVPEKFATLGLTYDDVLLLPGASAVLPNAVDTSSRISRNVRVNIPLLSAAMDKV
TESRMAISMARQGGVGVLHRNLSIEDQANQVDLVKRSESGMVANPITIHPDATLGEADAL
CAKFRISGVPVTDGAGKLLGIVTNRDMAFETDRSRQVREVMTPMPLVTGQVGISGVDAME
LLRRHKIEKLPLVDGDGILKGLITVKDFVKAEQYPHAAKDAKGRLLVGAAVGASPEALDR
AQALAEAGVDFLVVDTSHGHNSNALSWMSKIKSSVGIDVVGGNVATRDGAQALIDAGVDG
IKVGVGPGSICTTRVVAGIGVPQVTAIYEASLAARAAGVPLIGDGGLQYSGDIGKALAAG
ADTVMLGSLLAGCEESPGELQFINGKQFKSYRGMGSLGAMQSRGQGRSYSKDRYFQAEVA
SDDKLVPEGIEGQVPYRGPLANVLHQLVGGLRQTMGYVGAATIEEMESKGRFVRITSAGL
KESHPHDIQMTVEAPNYSRSK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaacgtcgacggagtgcccgagaaattcgcgacactcgggctgacctacgac
gacgtgctgctgctgccgggcgcctccgcggtgcttccgaacgcggtcgacacctcgtcc
cgcatctcccgcaacgtgcgggtcaacatcccgctgctctccgcggccatggacaaggtg
accgagtcccggatggccatctccatggcccgccagggcggcgtcggcgtcctgcaccgc
aacctgtccatcgaggaccaggccaaccaggtcgacctggtgaagcgctccgagtcgggc
atggtggccaaccccatcaccatccacccggacgccaccctcggcgaggccgacgccctg
tgcgccaagttccgcatcagcggcgtcccggtcaccgacggcgcgggcaagctgctcggc
atcgtcaccaaccgcgacatggccttcgagaccgaccgcagccggcaggtgcgcgaggtc
atgacgccgatgccgctggtcaccggccaggtcggcatctccggtgtggacgccatggag
ctgctgcgccgccacaagatcgagaagcttccgctggtcgacggcgacggcatcctcaag
ggcctgatcacggtcaaggacttcgtcaaggccgagcagtacccgcacgccgccaaggac
gccaagggccgcctgctcgtcggcgccgccgtcggcgccagccccgaggccctcgaccgc
gcccaggcgctcgccgaggcgggggtggacttcctcgtcgtcgacacctcgcacggccac
aacagcaacgcgctgagctggatgtcgaagatcaagtcgagcgtcggcatcgatgtcgtc
ggcggcaacgtcgccacccgcgacggcgcccaggccctgatcgacgccggcgtcgacggc
atcaaggtcggcgtcggccccggctccatctgcaccacccgcgtggtcgccggcatcggt
gtcccccaggtcaccgcgatctacgaggcctcgctcgcggcccgcgccgccggggtgccc
ctgatcggcgacggcggtctccagtactccggcgacatcggcaaggcgctcgccgccggt
gccgacaccgtgatgctgggcagcctgctggcgggctgcgaggagtcgccgggcgagttg
cagttcatcaacggcaagcagttcaagtcgtaccgcggcatgggctcgctgggcgccatg
cagtcccgcggccagggccggtcgtactcgaaggaccgctacttccaggccgaggtcgcc
tccgacgacaagctcgtgcccgagggcatcgagggccaggtcccctaccggggtccgctg
gccaacgtcctgcaccagctcgtcggcggtctgcgccagacgatgggctacgtgggcgcg
gccaccatcgaggagatggagtccaagggccgcttcgtccggatcacctccgcgggcctc
aaggagagccacccgcacgacatccagatgacggtcgaggcgccgaactacagccgcagc
aagtaa

DBGET integrated database retrieval system