KEGG   Streptomyces coelicolor: SCO4774Help
Entry
SCO4774           CDS       T00085                                 

Gene name
SCD63.06
Definition
(RefSeq) glycerol phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sco  Streptomyces coelicolor
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO4774 (SCD63.06)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCO4774 (SCD63.06)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5187291..5188997
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAQRAESLAAMAERELDVLVVGAGVVGAGTALDAVTRGLSVGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFVLVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSMARGHGRGLPLHRHLSRRHALRVAPALKKDALVGALQYYDAQMDDARF
VATLVRTAAAYGAKVANRARVTSFLREGERVVGARVQDVEAGGEYEVRAKQVVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNSVLSVPLTRDDVEGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDLRVADCVTEETPLLGAEGYHAQ
WNARARIAARTGLHVVRVEHLLNRYGSLTEELLELVAADPSLGEPLTGADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRCAREAAELMAPVLGWDKGQVEREIEHYEKRV
EAERESQRQPDDLTADAARLGAPDIAAR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacccttgggccggcgcagcgcgccgagtcactcgcggccatggccgag
cgcgaactcgacgtactggtggtgggcgccggcgtggtcggtgcgggcaccgccctcgac
gccgtgacgcgcggcctgtccgtcggcctggtcgaggcgcgggactgggcctcgggcacc
tccagcaggtccagcaagctgatccacggcggcctgcgctatctggagatgctcgacttc
gtgctcgtgcgggaggcgctgaaggagcgcggactgcttctggaacggctggcgccgcac
ctggtgaagccggtgccgttcctgtacccgctccagcacaagggctgggagcggctgtat
gccggatcgggcgtcgcgctctacgacgccatgtccatggcccgcgggcacgggcggggc
ctgccgctgcaccggcacctgagccgccgtcacgccctgcgcgtggcgcccgcgctgaag
aaggacgcgctggtcggcgcgttgcagtactacgacgcccagatggacgacgcccgcttc
gtggccacgctggtgcgcaccgcggcggcgtacggcgccaaggtcgccaaccgcgcccgg
gtcacctccttcctgcgcgagggcgaacgggtggtcggcgcccgggtgcaggacgtcgag
gcgggcggcgagtacgaggtccgcgccaagcaggtggtgaacgcgaccggggtgtggacc
gacgacacccaggcgatggtcggcgagcgcggccagttccacgtccgggcctccaagggc
atccacctggtcgtgcccaaggaccgcatccactccagcaccgggctgatcctgcgcacc
gagaagtccgtgctgttcgtcatcccctggggccggcactggatcatcggcaccacggac
accgactgggacctggacaaggcccacccggccgcgtccagcgccgacatcgactacctg
ctggaacacgtcaactcggtgctgtcggtgcccctcacgcgcgacgacgtcgagggcgtg
tacgccggactgcgcccgctgctggccggcgagtcggacgccaccagcaagctgtcgcgc
gagcacaccgtcgcccacccggtgcccggcctggtcgtcgtggccggcgggaagtacacg
acgtaccgggtgatggccaaggacgccgtcgacgaggccgtgcacgggctcgacctgcgg
gtcgccgactgcgtcaccgaggagacgccgctgctcggcgctgagggctaccacgcgcag
tggaacgcccgggcccggatcgccgcccgcaccggactgcacgtcgtacgcgtcgagcat
ctgctcaaccgctacggctcgctgacggaggaactgctcgaactcgtcgccgccgacccc
tccctgggcgagccgctcaccggcgccgacgactacctgcgcgccgaagtcgtctacgcc
gcctcgcacgagggcgcccggcacctggacgacgtactgacccggcgcacccgtatctcc
atcgagaccttcgaccggggcacgcgctgcgcccgcgaggccgccgagctgatggcaccg
gtcctcggctgggacaagggccaggtcgagcgggagatcgagcactacgagaagcgggtc
gaggccgagcgggagtcccagcgccagcccgacgacctgacggccgacgcggcccggctg
ggggcgccggacatcgcggcgcggtga

DBGET integrated database retrieval system