KEGG   Streptomyces coelicolor: SCO4780Help
Entry
SCO4780           CDS       T00085                                 

Gene name
gabD2
Definition
(RefSeq) succinic semialdehyde dehydrogenase
  KO
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO4780 (gabD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO4780 (gabD2)
   00310 Lysine degradation
    SCO4780 (gabD2)
   00350 Tyrosine metabolism
    SCO4780 (gabD2)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO4780 (gabD2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SCO4780 (gabD2)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SCO4780 (gabD2)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SCO4780 (gabD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5199496..5201109
Genome map
AA seq 537 aa AA seqDB search
MTDAQAPELTGTNPLAPTPEGARTAADVVTPELVAQLTKGVAGSGRTANHTPFTGEKLAD
LPESTPEDVAGAFERARAAQAVWAQVPVRQRAAVLLRFHDLVLERQAEVLDLIQLETGKA
RLHAHEEVQAVAVAARHYGRKAPAYLRPKRHTGAVPTLTKVTELRHPRGVVGQIAPWNYP
LELSVGDALPAFVAGNAVVMKPDTETCLTALWARDLLIEAGLPAEVFQVVLGDGPVVGPE
VVRHADYVSFTGSTRTGREVAQGAAARLVGVSLELGGKNAMLVLEDADIEKAAAGAVRAC
FSSAGQLCISIERLYVHASVADAFLERFAARTRAMRLGTSLSYGADMGSLVGERQLATVT
AHVADAVERGAKLVAGGVARPDIGPYFYEPTILDGVVAPMTVCAEETFGPVVSVYRFTTE
DEAVEHANSTPYGLNSSVWTKDARRGRDVAARLRTGTVNINEGYAPAYGSVQSPMGGMKD
SGLGRRHGSEGILKYTEAQTVAHQRLLPMAPSLGMDDEKYAAFMSRSLRLMKSLRFR
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgcgcaggccccggaactcaccggcacgaaccccctcgcccccaccccggag
ggcgcccgcaccgctgccgacgtggtcacgcccgagctggtcgcccagctcaccaagggc
gtggccgggtccggccgcaccgccaaccacaccccgttcaccggcgagaagctggccgac
ctgcccgagtcgacgcccgaggacgtggccggagccttcgagcgggcccgcgccgcccag
gccgtgtgggcgcaggtgccggtgcggcagcgggccgcggtcctgctgcgcttccacgac
ctggtcctggagcggcaggccgaggtcctcgacctcatccagctggagaccggcaaggcc
cgcctgcacgcccacgaggaggtccaggccgtcgccgtcgccgcccggcactacggccgc
aaggccccggcgtacctgcgccccaagcggcacaccggcgccgtaccgaccctcaccaag
gtcaccgagctgcgccacccgcgcggcgtcgtcggccagatcgccccctggaactacccg
ctggagctgtccgtcggcgacgcgctccccgccttcgtcgcgggcaacgccgtcgtgatg
aagcccgacaccgagacctgcctgaccgccctgtgggcccgtgacctgctcatcgaggcc
gggctgcccgccgaggtcttccaggtcgtgctcggcgacggcccggtcgtcggccccgag
gtcgtcaggcacgccgactacgtctccttcaccggttccacccgcaccggccgcgaggtc
gcccagggggccgccgcccgcctggtcggcgtctccctggaactcggcggcaagaacgcc
atgctggtcctggaggacgccgacatcgagaaggccgcggcgggcgccgtccgcgcctgc
ttctcctcggccggccagctgtgcatctccatcgagcggctctacgtccacgcgtccgtc
gccgacgccttcctggagcgcttcgccgcccgcaccagggccatgcggctcggcacctcc
ctctcctacggcgccgacatgggctcgctggtgggggagcggcagctggcgaccgtgacg
gcgcacgtggcggacgccgtggagcggggcgcgaagctcgtcgccggcggtgtcgcccgc
ccggacataggcccgtacttctacgagccgaccatcctcgacggtgtcgtggcccccatg
acggtgtgcgccgaggagaccttcggcccggtcgtctccgtctaccgcttcacgaccgag
gacgaggccgtcgagcacgccaactccacgccgtacggcctgaactcctcggtctggacg
aaggacgcccggcgcggccgcgacgtcgccgcccggctgcgcaccggcaccgtcaacatc
aacgaggggtacgcgcccgcctacggcagcgtgcagtccccgatgggcggcatgaaggac
tccggcctcggccgccggcacggctccgagggcatcctcaagtacaccgaggcccagacc
gtcgcccaccagcgcctgctgccgatggcgccctcgctcggcatggacgacgagaagtac
gcggcgttcatgagccgcagtctccggctcatgaagagtctccggttccggtag

DBGET integrated database retrieval system