KEGG   Streptomyces coelicolor: SCO4800Help
Entry
SCO4800           CDS       T00085                                 

Gene name
icmB, SCD63A.11
Definition
(RefSeq) isobutyryl-CoA mutase, small subunit
  KO
K01849  
methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4800 (icmB)
   00640 Propanoate metabolism
    SCO4800 (icmB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4800 (icmB)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SCO4800 (icmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5224492..5224908
Genome map
AA seq 138 aa AA seqDB search
MGVAAGPIRVVVAKPGLDGHDRGAKVIARALRDAGMEVIYTGLHQTPEQIVDTAIQEDAD
AIGLSILSGAHNTLFAAVIELLRERDAADILVFGGGIIPEADIAPLKEKGVAEIFTPGAT
TASIVDWVRANVREPAGA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggcagccggtccgatccgcgtggtggtggccaagccggggctcgacggccac
gatcgcggggccaaggtgatcgcgagggccctgcgtgacgccggtatggaggtgatctac
accgggctccaccagacgcccgagcagatcgtcgacaccgcgatccaggaggacgccgac
gcgatcgggctgtccatcctctccggtgcgcacaacacgctcttcgccgccgtgatcgag
ctgctccgggagcgggacgccgcggacatcctggtcttcggcggcgggatcatccccgag
gcggacatcgccccgctgaaggagaagggcgtcgcggagatcttcacgcccggcgccacc
acggcgtccatcgtggactgggtccgggcgaacgtgcgggagcccgcgggagcatag

DBGET integrated database retrieval system