KEGG   Streptomyces coelicolor: SCO4800Help
Entry
SCO4800           CDS       T00085                                 

Gene name
icmB, SCD63A.11
Definition
(RefSeq) isobutyryl-CoA mutase, small subunit
  KO
K01849  
methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4800 (icmB)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4800 (icmB)
   00640 Propanoate metabolism
    SCO4800 (icmB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4800 (icmB)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SCO4800 (icmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5224492..5224908
Genome map
AA seq 138 aa AA seqDB search
MGVAAGPIRVVVAKPGLDGHDRGAKVIARALRDAGMEVIYTGLHQTPEQIVDTAIQEDAD
AIGLSILSGAHNTLFAAVIELLRERDAADILVFGGGIIPEADIAPLKEKGVAEIFTPGAT
TASIVDWVRANVREPAGA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggcagccggtccgatccgcgtggtggtggccaagccggggctcgacggccac
gatcgcggggccaaggtgatcgcgagggccctgcgtgacgccggtatggaggtgatctac
accgggctccaccagacgcccgagcagatcgtcgacaccgcgatccaggaggacgccgac
gcgatcgggctgtccatcctctccggtgcgcacaacacgctcttcgccgccgtgatcgag
ctgctccgggagcgggacgccgcggacatcctggtcttcggcggcgggatcatccccgag
gcggacatcgccccgctgaaggagaagggcgtcgcggagatcttcacgcccggcgccacc
acggcgtccatcgtggactgggtccgggcgaacgtgcgggagcccgcgggagcatag

DBGET integrated database retrieval system