KEGG   Streptomyces coelicolor: SCO4809Help
Entry
SCO4809           CDS       T00085                                 

Gene name
SCD63A.20, sucD
Definition
(RefSeq) succinyl-CoA synthetase subunit alpha
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
   00020 Citrate cycle (TCA cycle)
    SCO4809 (SCD63A.20)
   00640 Propanoate metabolism
    SCO4809 (SCD63A.20)
   00660 C5-Branched dibasic acid metabolism
    SCO4809 (SCD63A.20)
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCO4809 (SCD63A.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5236206..5237090
Genome map
AA seq 294 aa AA seqDB search
MAIWLNKDSKVIVQGMTGATGMKHTKLMLGDGTEVVGGVNPRKAGTSVDFDGNEVPVFGT
VKEAIEKTGANVSVIFVPEKFTKDAVVEAIDAEIPLAVVITEGIAVHDSAAFWSYAGKKG
NKTRIIGPNCPGIITPGQSNVGIIPGDITKPGRIGLVSKSGTLTYQMMYELRDIGFSTAV
GIGGDPIIGTTHIDALAAFEADPETDLIVMIGEIGGDAEERAAEYISKNVTKPVVGYVAG
FTAPEGKTMGHAGAIVSGSSGTAQAKKEALEAAGVKVGKTPTETAKLARAILAG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctatctggctcaacaaggacagcaaggtcatcgtccagggcatgaccggtgccacc
ggcatgaagcacaccaagctcatgctgggtgacggcaccgaggtcgtgggcggcgtgaac
ccgcgcaaggcgggcacctccgtggacttcgacggcaacgaggtaccggtcttcggcacc
gtcaaggaggccatcgagaagaccggcgccaacgtctccgtcatcttcgtgccggagaag
ttcaccaaggacgccgtcgtcgaggccatcgacgccgagatcccgctggccgtcgtcatc
accgagggcatcgccgtgcacgactcggccgccttctggtcgtacgccggcaagaagggc
aacaagacccggatcatcggcccgaactgccccggcatcatcacgccgggccagtccaac
gtcggcatcatcccgggcgacatcaccaagccgggccgcatcggcctggtctcgaagtcc
ggcacgctgacgtaccagatgatgtacgagctgcgtgacatcggcttctcgaccgccgtc
ggcatcggtggcgacccgatcatcggcaccacgcacatcgacgcgctcgccgcgttcgag
gccgaccccgagaccgacctgatcgtcatgatcggcgagatcggcggcgacgccgaggag
cgtgcggccgagtacatctcgaagaacgtgacgaagccggtcgtcggctacgtcgcgggc
ttcaccgcgcccgagggcaagaccatgggccacgccggcgccatcgtctccggttcgtcc
ggcaccgcccaggcgaagaaggaggccctggaggccgccggcgtcaaggtcggcaagacg
ccgaccgagacggcgaagctcgcccgcgccatcctggccggctga

DBGET integrated database retrieval system