KEGG   Streptomyces coelicolor: SCO4809Help
Entry
SCO4809           CDS       T00085                                 

Gene name
SCD63A.20, sucD
Definition
(RefSeq) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00640  Propanoate metabolism
sco00660  C5-Branched dibasic acid metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO4809 (SCD63A.20)
   00640 Propanoate metabolism
    SCO4809 (SCD63A.20)
   00660 C5-Branched dibasic acid metabolism
    SCO4809 (SCD63A.20)
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCO4809 (SCD63A.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 1100250
NCBI-ProteinID: NP_628966
Kitasato: SCO4809
UniProt: Q9KY55
Position
5236206..5237090
Genome map
AA seq 294 aa AA seqDB search
MAIWLNKDSKVIVQGMTGATGMKHTKLMLGDGTEVVGGVNPRKAGTSVDFDGNEVPVFGT
VKEAIEKTGANVSVIFVPEKFTKDAVVEAIDAEIPLAVVITEGIAVHDSAAFWSYAGKKG
NKTRIIGPNCPGIITPGQSNVGIIPGDITKPGRIGLVSKSGTLTYQMMYELRDIGFSTAV
GIGGDPIIGTTHIDALAAFEADPETDLIVMIGEIGGDAEERAAEYISKNVTKPVVGYVAG
FTAPEGKTMGHAGAIVSGSSGTAQAKKEALEAAGVKVGKTPTETAKLARAILAG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctatctggctcaacaaggacagcaaggtcatcgtccagggcatgaccggtgccacc
ggcatgaagcacaccaagctcatgctgggtgacggcaccgaggtcgtgggcggcgtgaac
ccgcgcaaggcgggcacctccgtggacttcgacggcaacgaggtaccggtcttcggcacc
gtcaaggaggccatcgagaagaccggcgccaacgtctccgtcatcttcgtgccggagaag
ttcaccaaggacgccgtcgtcgaggccatcgacgccgagatcccgctggccgtcgtcatc
accgagggcatcgccgtgcacgactcggccgccttctggtcgtacgccggcaagaagggc
aacaagacccggatcatcggcccgaactgccccggcatcatcacgccgggccagtccaac
gtcggcatcatcccgggcgacatcaccaagccgggccgcatcggcctggtctcgaagtcc
ggcacgctgacgtaccagatgatgtacgagctgcgtgacatcggcttctcgaccgccgtc
ggcatcggtggcgacccgatcatcggcaccacgcacatcgacgcgctcgccgcgttcgag
gccgaccccgagaccgacctgatcgtcatgatcggcgagatcggcggcgacgccgaggag
cgtgcggccgagtacatctcgaagaacgtgacgaagccggtcgtcggctacgtcgcgggc
ttcaccgcgcccgagggcaagaccatgggccacgccggcgccatcgtctccggttcgtcc
ggcaccgcccaggcgaagaaggaggccctggaggccgccggcgtcaaggtcggcaagacg
ccgaccgagacggcgaagctcgcccgcgccatcctggccggctga

DBGET integrated database retrieval system