KEGG   Streptomyces coelicolor: SCO4813Help
Entry
SCO4813           CDS       T00085                                 

Gene name
purN
Definition
(RefSeq) phosphoribosylglycinamide formyltransferase
  KO
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4813 (purN)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO4813 (purN)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     SCO4813 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5241331..5241978
Genome map
AA seq 215 aa AA seqDB search
MAAKPVDRRAKRLVVLVSGSGTNLQALLDEIATTGAEAYGAEIVAVGADRDGIEGLARAE
RAGVTTFVRRVKDYGTREEWDAALAESVAAHEPDLVVSAGFMKIVGKEFLARFGGRFVNT
HPALLPSFPGAHGVRDALAYGARVTGCTVHFVDDGVDTGPIIAQGVVEVRDEDYEDEGVA
LHERIKEVERRLLVDVVGRLARNGYRIEGRKVVIQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccaagcccgtggaccggcgagccaagcgcctcgtcgtgctggtctccggatcc
ggcaccaacctccaggcgctcctcgacgagatcgccaccaccggggccgaggcctacggt
gccgagatcgtcgcggtcggcgccgaccgcgacggcatcgaggggctcgcccgcgccgag
cgggccggggtgacgaccttcgtccgcagggtcaaggactacgggacccgcgaggagtgg
gacgcggcactcgccgagtccgtcgcggcccacgagccggacctcgtcgtctcggccggg
ttcatgaagatcgtggggaaggagttcctcgcgcggttcggcgggcggttcgtcaacacc
caccccgccctcctccccagctttccgggggcccacggcgtacgggacgcgctcgcgtac
ggcgccagggtcaccggctgcaccgtccacttcgtcgacgacggcgtcgacaccgggccg
atcatcgcgcagggcgtggtggaggtccgggacgaggactacgaagacgaaggtgtcgct
ctgcacgagcgcatcaaggaagtcgagcgaaggctgctcgtcgatgtcgtggggcggctc
gcccgcaacggctatcgcattgagggacgaaaggtagttatccagtga

DBGET integrated database retrieval system