KEGG   Streptomyces coelicolor: SCO4824Help
Entry
SCO4824           CDS       T00085                                 

Gene name
folD, SC2A6.09
Definition
(RefSeq) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase
  KO
K01491  
methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sco  Streptomyces coelicolor
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4824 (folD)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO4824 (folD)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SCO4824 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SCO4824 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
5253981..5254835
Genome map
AA seq 284 aa AA seqDB search
MTAQILDGKATAAAIKSELTARVAALKERGVTPGLGTVLVGDDPGSQKYVAGKHRDCAQV
GIASIQRELPATATQEEIEAVVRELNEDPACTGYIVQLPLPRGIDENRILELMDPDKDAD
GLHPMNLGRLVLNEPAPLPCTPNGILTLLRRYGVEIKGAEVVVVGRGVTIGRPMPLLLTR
RSENATVTQCHTGTRDLAAHLKRADIVIAAAGSPHLVRPEDVKPGAAVLDVGVSRNAEGK
IMGDVHPGVAEVAAWISPNPGGVGPMTRAQLLVNVVEAAERSAG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagattctcgatggcaaggccaccgcagccgcgatcaagtccgaactgacc
gcccgcgtggcggcgctgaaggagaggggcgtcacgcccggcctcggcaccgtcctggtc
ggcgacgatccaggcagccagaagtacgtcgccggcaagcaccgcgactgcgcccaggtc
ggcatcgcgtccatccagcgcgaactgccggccacggccacgcaggaggagatcgaggcg
gtcgtccgcgagctgaacgaggacccggcctgtacggggtacatcgtccagctgccgctg
cccaggggcatcgacgagaaccgcatcctcgaactgatggacccggacaaggacgcggac
ggcctgcacccgatgaacctgggccgcctcgtcctgaacgagccggcaccgctgccctgc
acccccaacggcatcctcaccctgctgcgccgctacggcgtcgagatcaagggcgccgag
gtcgtggtcgtcggccgcggcgtcaccatcggccgcccgatgccgctgctgctcacccgg
cgcagcgagaacgccacggtgacccagtgccacaccggcacccgggacctggccgcccac
ctgaagcgcgcggacatcgtgatcgccgcggccggttccccgcacctggtgcggcccgag
gacgtcaagccgggcgcggccgtcctggacgtcggcgtctcccgcaacgccgagggcaag
atcatgggcgacgtgcaccccggcgtggccgaggtggccgcctggatctcccccaacccc
ggcggcgtcggcccgatgacccgggcccagctgctcgtcaacgtggtggaggcggcggag
cgcagtgccggctga

DBGET integrated database retrieval system