KEGG   Streptomyces coelicolor: SCO4827Help
Entry
SCO4827           CDS       T00085                                 

Gene name
mdh, SC2A6.12
Definition
(RefSeq) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4827 (mdh)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO4827 (mdh)
   00620 Pyruvate metabolism
    SCO4827 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4827 (mdh)
  Energy metabolism
   00680 Methane metabolism
    SCO4827 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO4827 (mdh)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SCO4827 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5257517..5258506
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALKAAEGTAMELDD
CAFPLLQGIEITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSTVADIK
RLTIWGNHSATQYPDIFHATVAGKNAAETVNDEKWLADEFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVYTWVNGTAEGDWTSMGIPSDGSYGVPEGIISSFPVTTKDGSYEIVQGLD
INEFSRARIDASVKELSEEREAVRGLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctgcgc
ctcctggagatcaccccggcgctcaaggccgccgagggcaccgcgatggagctggacgac
tgcgcgttcccgctgctccagggcatcgagatcaccgacgacccgaacgtggccttcgac
ggcgccaacgtcgccctcctcgtcggcgcccgcccccgcaccaagggcatggagcgcggc
gacctcctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgcggacgacatcaaggtcctcgtcgtcggcaacccggccaacaccaacgccctgatc
gcccaggccgccgctccggacgtaccggccgagcgcttcaccgcgatgacccgcctagac
cacaaccgcgccctgacccagctcgcgaagaagaccggctcgacggtcgccgacatcaag
cgcctgaccatctggggcaaccactcggccacccagtacccggacatcttccacgccacc
gtcgcgggcaagaacgccgccgagaccgtcaacgacgagaagtggctggccgacgagttc
atcccgaccgtcgccaagcgcggtgccgccatcatcgaggcccgcggcgcctcctcggcc
gcctccgccgccaacgccgccatcgaccacgtgtacacctgggtcaacggcactgccgag
ggcgactggacctccatgggcatcccgtcggacggctcctacggcgtccccgagggcatc
atctcctccttcccggtcaccacgaaggacggctcgtacgagatcgtccagggcctggac
atcaacgagttctcccgcgcccgcatcgacgcctccgtcaaggagctgtcggaggagcgc
gaggcggtgcgcggtctcggcctcatctga

DBGET integrated database retrieval system