KEGG   Streptomyces coelicolor: SCO4869Help
Entry
SCO4869           CDS       T00085                                 

Gene name
mutA2, SCK20.10
Definition
(RefSeq) methylmalonyl CoA mutase
  KO
K01848  
methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4869 (mutA2)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO4869 (mutA2)
   00640 Propanoate metabolism
    SCO4869 (mutA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4869 (mutA2)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SCO4869 (mutA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5297557..5299161
Genome map
AA seq 534 aa AA seqDB search
MLSGRHHTMTRESESGLPIEPVYGPEALADWEAAEKLGEPGKYPFTRGVYPSMYTGRPWT
MRQYAGFGTATESNARYKQLIANGTMGLSVAFDLPTQMGHDSDAPIASGEVGKVGVAIDS
IDDMRVLFGGIPLDKVSTSMTINAPASLLLLLYQLVAEEQGVSADQLTGTIQNDVLKEYI
ARGTYIFPPKPSLRLIADIFKYCRAEIPKWNTISISGYHMAEAGASPAQEIAFTLADGIE
YVRTAVAAGMDVDDFAPRLSFFFVARTTILEEVAKFRAARRIWARVMKEEFGAKNPKSLM
LRFHTQTAGVQLTAQQPEVNLVRVAVQGLGAVLGGTQSLHTNSFDEAIALPTDKSARLAL
RTQQVLAYETDVTATVDPFAGSYVVEKMTDDVEAAALELMGKVEDLGGAVNAIEHGFQKS
EIERSAYRIAQETDSGERVVVGVNRYQLDEEEPYEPLRVDPAIEAQQADRLAALRAERDQ
TAVDSALAALKKAAEGEDNVLYPMKDALRARATVGEVCNALREVWGTYVPSDAF
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgctcagcgggaggcatcacaccatgacgcgcgagtccgagtccgggctgcccatcgaa
ccggtctacgggcccgaagccctggcggactgggaggcggccgagaagctgggcgagccc
gggaagtacccgttcacccggggcgtgtacccgtccatgtacaccggccggccgtggacg
atgcgccagtacgccggtttcggcacggcgacggagtccaacgcccgctacaagcagctg
atcgccaacggcaccatgggcctgtcggtcgccttcgacctgcccacccagatgggccac
gactccgacgcgccgatcgcgagcggcgaggtcggcaaggtcggcgtcgccatcgactcc
atcgacgacatgcgcgtgctgttcggcgggatcccgctggacaaggtctccacgtcgatg
acgatcaacgccccggcctcgctgctgctcctgctctaccaactcgtcgccgaggagcag
ggcgtgagcgccgaccagctcaccggcacgatccagaacgacgtgctgaaggagtacatc
gcgcgcgggacgtacatcttcccgcccaagccgtcgctgcgcctgatcgcggacatcttc
aagtactgccgggccgagatcccgaagtggaacaccatctcgatctccggctaccacatg
gccgaggccggtgcctcgcccgcgcaggagatcgccttcaccctcgcggacggcatcgag
tacgtgcgcaccgcggtcgcggccggcatggacgtcgacgacttcgcgccccgcctctcc
ttcttcttcgtggcccgcacgacgatcctggaggaggtcgccaagttccgcgcggcccgc
cggatctgggcccgggtgatgaaggaggagttcggcgcgaagaaccccaagtcgctgatg
ctgcgcttccacacccagaccgcgggcgtgcagctgaccgcccagcagcccgaggtgaac
ctggtgcgcgtcgccgtgcagggcctcggcgcggtcctcggcggcacgcagtcgctgcac
accaactccttcgacgaggccatcgcgctgcccaccgacaagtcggcgcgcctcgccctg
cgcacccagcaggtgctcgcctacgagacggacgtgacggcgaccgtcgaccccttcgcc
ggctcctacgtcgtggagaagatgaccgacgacgtcgaggcggcggcgctggagctgatg
ggcaaggtcgaggacctcggcggcgcggtcaacgccatcgagcacggcttccagaagagc
gagatcgagcgctccgcctaccgcatcgcccaggagaccgactccggcgagcgggtcgtg
gtcggcgtcaaccgctaccagctcgacgaggaggagccctacgagccgctccgcgtcgac
ccggccatcgaggcccagcaggccgaccggctggccgcgctccgcgcggagcgcgaccag
acggcggtggactcggccctggcggccctgaagaaggcggccgagggcgaggacaacgtc
ctgtacccgatgaaggacgcgctgcgggcgcgcgcgacggtcggcgaggtgtgcaacgcg
ctgcgggaggtctgggggacctacgtcccttcggacgcgttctga

DBGET integrated database retrieval system