KEGG   Streptomyces coelicolor: SCO4913Help
Entry
SCO4913           CDS       T00085                                 

Gene name
SCK13.05c
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO4913 (SCK13.05c)
   00053 Ascorbate and aldarate metabolism
    SCO4913 (SCK13.05c)
   00620 Pyruvate metabolism
    SCO4913 (SCK13.05c)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO4913 (SCK13.05c)
   00561 Glycerolipid metabolism
    SCO4913 (SCK13.05c)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO4913 (SCK13.05c)
   00310 Lysine degradation
    SCO4913 (SCK13.05c)
   00330 Arginine and proline metabolism
    SCO4913 (SCK13.05c)
   00340 Histidine metabolism
    SCO4913 (SCK13.05c)
   00380 Tryptophan metabolism
    SCO4913 (SCK13.05c)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO4913 (SCK13.05c)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCO4913 (SCK13.05c)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCO4913 (SCK13.05c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SCO4913 (SCK13.05c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5345752..5347194)
Genome map
AA seq 480 aa AA seqDB search
MASAPAFDYAPAPESRAVVDIAPSYGVFIDGEFTEAADGKVFKTVSPATEEVLSEVAEAG
EADVDRAVKAARKAFEKWSALPGAERAKYLFRIARIIQERSRELAVLETLDNGKPIRETR
DADLPLVAAHFFYYAGWADKLDHAGYGADPRPLGVAGQVIPWNFPLLMLAWKIAPALATG
NTVVLKPAETTPLSALFFADICRQAGLPKGVVNIITGDGRAGAALTAHPDVNKVAFTGST
AVGKQIARTVAGTRKKLTLELGGKGANIVFDDAPIDQAVEGIVNGIFFNQGQVCCAGSRL
LVQESIHDELLDSLKRRLTTLRLGDPLDKNTDIGAINSAEQLARITALADQGEAEGAERW
SPACELPSAGYWFAPTLFTNVTQAHTVARDEIFGPVLSVLTFRTPDEAVAKANNTPYGLS
AGIWTEKGSRILAVANKLRAGVIWSNTFNKFDPTSPFGGYKESGFGREGGRHGLEAYLDV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgcacccgcattcgactacgcaccggcacccgagtcccgcgcggtcgtcgac
atcgccccctcctacggcgtgttcatcgacggcgagttcaccgaggcggccgacggcaag
gtcttcaagacggtctcccccgccaccgaggaggtcctctccgaggtcgccgaggccggc
gaggcggacgtcgaccgcgccgtgaaggccgcccgcaaggccttcgagaagtggtcggcg
ctgcccggcgcggagcgtgcgaagtacctcttccgcatcgcccgcatcatccaggaacgc
agccgggaactggccgtcctggaaaccctcgacaacggcaagccgatcagggagacccgc
gacgcggacctccccctggtcgccgcgcacttcttctactacgcgggctgggccgacaag
ctggaccacgccggctacggcgccgacccccgccccctgggcgtggcgggccaggtcatc
ccctggaacttcccgctcctgatgctggcgtggaagatcgccccggccctggccaccggc
aacacggtggtcctgaagcccgccgagacgacccccctctccgccctgttcttcgcggac
atctgccgccaggccgggctgcccaagggcgtcgtcaacatcatcaccggcgacggccgc
gccggggcggcactcaccgcccaccccgacgtgaacaaggtcgcctttacgggctccacg
gcggtcggcaagcagatcgcgcgcacggtcgcgggcacccgcaagaagctcaccctcgaa
ctgggcggcaagggcgccaacatcgtcttcgacgacgccccgatcgaccaggccgtagag
ggcatcgtcaacggcatcttcttcaaccagggccaggtctgctgcgcgggcagccgcctc
ctggtccaggagtcgatccacgacgagctgctggactccctgaagcgcaggctcaccacc
ctccgcctgggcgacccgctggacaagaacacggacatcggcgcgatcaactccgccgag
cagctggcccgtatcaccgccctcgccgaccagggcgaggcggagggcgccgagcgctgg
tccccggcctgcgaactgccctccgccggctactggttcgccccgacgctcttcacgaac
gtcacccaggcgcacacggtcgcccgcgacgagatcttcggcccggtcctgtccgtcctc
accttccgcacgccggacgaggcggtcgccaaggccaacaacacgccgtacggcctgtcg
gcgggcatctggacggagaagggctcgcgcatcctggcggtcgcgaacaagctccgtgcc
ggtgtgatctggtccaacacgttcaacaagttcgacccgacgtcgccgttcggcggctac
aaggagtcgggcttcggccgcgagggcggccgccacggcctggaggcgtacctcgatgtc
tga

DBGET integrated database retrieval system