KEGG   Streptomyces coelicolor: SCO4917Help
Entry
SCO4917           CDS       T00085                                 

Gene name
SCK13.09c
Definition
(RefSeq) purine nucleoside phosphorylase
  KO
K03783  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4917 (SCK13.09c)
   00240 Pyrimidine metabolism
    SCO4917 (SCK13.09c)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO4917 (SCK13.09c)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     SCO4917 (SCK13.09c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5351124..5351948)
Genome map
AA seq 274 aa AA seqDB search
MNASLLPDDIQGDPYAAADAAAARLRELTGAETHDVALVMGSGWAPAVDALGAPEADLQV
TDLPGFPEPAVEGHGGKVRSYTLGDKRALVFLGRTHYYEGHGVAAVSHGVRTAVAAGAKT
IILTNGCGGLREGMRPGQPVLISDHINLTATSPIVGANFVDLTDLYSPRLRALCKEVDAT
LEEGVYAQFPGPHYETPAEIRMARVIGADLVGMSTVLEAIAAREAGAEVLGISLVTNLAA
GMTGEPLNHEEVLQAGRDSAARMGTLLTQVLGKL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcatctcttcttccggacgacatccagggcgacccgtacgccgccgccgacgcc
gccgcggcccgcctgcgcgaactcaccggcgccgagacccacgacgtcgccctcgtgatg
ggctccggctgggcaccggccgtggacgccctgggcgcccccgaggccgatctccaggtc
accgacctcccgggcttccccgagcccgcggtggagggccacggcggcaaggtccgctcg
tacaccctcggcgacaagcgcgcactggtcttcctgggccgcacccactactacgagggc
cacggcgtcgccgccgtctcccacggcgtccgcaccgcggtcgccgccggcgccaagacg
atcatcctgaccaacggctgcggcggcctgcgcgagggcatgcgccccggccagccggtc
ctgatcagcgaccacatcaacctcaccgccacctcccccatcgtcggcgccaacttcgtc
gacctcaccgacctctactccccccgcctgcgggccctgtgcaaggaggtcgacgccacc
ctcgaggagggcgtctacgcccagttccccggcccgcactacgagaccccggccgagatc
cgcatggcccgcgtgatcggcgccgacctggtgggcatgtcgacggtcctggaggcgatc
gcggcccgcgaggccggggcggaggtgctgggcatctccctggtcaccaacctcgccgcg
ggcatgacgggcgagcccctcaaccacgaggaggtcctccaggcgggccgcgactccgcc
gcccgcatggggaccctgctgacccaggtcctgggcaagctgtag

DBGET integrated database retrieval system