KEGG   Streptomyces coelicolor: SCO4930Help
Entry
SCO4930           CDS       T00085                                 

Gene name
SCK13.22
Definition
(RefSeq) enoyl-CoA hydratase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5363797..5364597
Genome map
AA seq 266 aa AA seqDB search
MSEERFGEFVLVRRRGEGHVAELALDRPKAMNAVSTAMARSVGAACAALGEDRSVRVVVL
TSTHERAFCVGADLKERNSFTDADLLRQRPVTRGAYTAVLELPVPTVAAVHGFALGGGFE
LALSCDVIVADPTAVVGLPEVSVGVIPGGGGTQLLPRRVGAARAAELVFTARRVAAEEAR
ELGLVDQLVPEGRDREEALELAARMAANSPVGLRAAKRALRLGHGLDLRAGLEVEDAAWR
SVAFSGDRAEGVAAFNEKRAPRWPGE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggagcggttcggagagttcgtcctggtgcggcggcgcggggaggggcatgtc
gcggaactcgcgctcgaccggccgaaggccatgaacgccgtgtcgaccgcgatggcccgt
tccgtgggcgcggcctgcgcggcgctgggcgaggaccggagcgtgcgggtggtggtgctg
acctcgacgcacgagcgggcgttctgcgtgggtgcggacctgaaggagcgcaactccttc
accgacgccgatctgctgcggcagcggccggtgacgcgcggggcgtacaccgcggtgctg
gagctgccggtgccgacggtcgcggccgtgcatgggttcgcgctgggtggcgggttcgag
ctggcgctgtcgtgcgacgtgatcgtggccgaccccacggccgtggtggggctgccggag
gtgtcggtgggggtgatcccgggcggcggcggtacgcagctgctgccgcgccgggtgggt
gcggcgcgagcggccgagctggtgttcacggcacggcgggtggcggccgaggaggcacgc
gagctggggctcgtggaccagctggtgccggaggggcgggaccgggaggaggcgctggag
ctggccgcccggatggccgcgaactcgcccgtgggcctgcgcgcggccaagcgcgcgctg
cgcctggggcacggactggacctgcgcgcgggactcgaggtcgaggacgcggcgtggcgt
tcggtggcgttctcgggggaccgcgccgagggagtggcggcgttcaacgagaagcgggcg
ccgcggtggccgggcgagtga

DBGET integrated database retrieval system