KEGG   Streptomyces coelicolor: SCO4945Help
Entry
SCO4945           CDS       T00085                                 

Gene name
2SCK31.05
Definition
(RefSeq) dehydrogenase
  KO
K13979  
uncharacterized zinc-type alcohol dehydrogenase-like protein [EC:1.-.-.-]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     SCO4945 (2SCK31.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5378899..5379939
Genome map
AA seq 346 aa AA seqDB search
MTTVAAYAAPAAKAPLERTTIERREVREHDVLIDIKFAGICHSDIHQAREGWGEAIFPMV
PGHEIAGIVSEVGPGVTRFKVGDRVGVGCMVDSCRECENCKAGREQYCTSGNTGTYNAVG
RDGEVTYGGYSEKVVVDENFVLGIPEGIALDEAAPLLCAGITTYSPLKRWNAGPGKKVAV
VGLGGLGHMAVKLAHALGAEVTVLSQSLRKKDDGLKLGADHYYATSDPATFEELSGTFDL
IVSTVSAPLDLGAYLGLLKTEGTLANVGAPEEPVSLNLFALLGGGKSLSGSMIGGIAETQ
EMLDFCAEHGIGAEIELIAASEINEAYERVLSSDVRYRFVIDTATI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgtcgccgcgtacgcagcacccgccgccaaggcgccgctggagcgcaccacc
atcgagcggcgcgaggtgcgtgaacacgacgtcctgatcgacatcaagttcgccggcatc
tgccactccgacatccaccaggcccgcgagggctggggcgaggccatcttcccgatggtc
cccggccacgagatcgcgggcatcgtgtccgaggtcggccccggcgtcaccaggttcaag
gtcggcgaccgggtgggcgtcggctgcatggtcgactcctgccgcgagtgcgagaactgc
aaggccggccgggagcagtactgcaccagcggcaacaccggcacgtacaacgccgtcggc
agggacggcgaggtcacctacggcggctactccgagaaggtcgtcgtcgacgagaacttc
gtcctcggcatccccgagggcatcgccctggacgaggccgcccccctgctgtgcgccggc
atcaccacctactccccgctcaagcgctggaacgcgggtcccggcaagaaggtcgccgtc
gtcggcctgggcggcctcggtcacatggccgtcaagctcgcgcacgccctgggcgccgag
gtgaccgtgctgtcgcagtccctgcgcaagaaggacgacggcctgaagctgggcgccgac
cactactacgccaccagcgacccggccaccttcgaggagctgtccggcaccttcgacctg
atcgtctccacggtctcggccccgctcgacctcggcgcctacctggggctgctgaagacg
gagggcacgctggccaacgtcggcgcccccgaggagccggtctccctcaacctgttcgcg
ctgctcggcgggggcaagtccctctccggctccatgatcggcggtatcgccgagacccag
gagatgctggacttctgcgcggagcacggcatcggtgccgagatcgagctgatcgccgcc
tccgagatcaacgaggcctacgagcgcgtcctgtccagcgacgtgcgctaccgcttcgtg
atcgacaccgcgacgatctga

DBGET integrated database retrieval system