KEGG   Streptomyces coelicolor: SCO4947Help
Entry
SCO4947           CDS       T00085                                 

Gene name
2SCK31.07, narG3
Definition
(RefSeq) nitrate reductase subunit alpha NarG3
  KO
K00370  
nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.4]
Organism
sco  Streptomyces coelicolor
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SCO4947 (2SCK31.07)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO4947 (2SCK31.07)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     SCO4947 (2SCK31.07)
   1.7.99  With unknown physiological acceptors
    1.7.99.4  nitrate reductase
     SCO4947 (2SCK31.07)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5381148..5384831
Genome map
AA seq 1227 aa AA seqDB search
MADAADRLLKAGQLLRRSPTTLDLRAVYRTDQNVNDRPYRERWAHDKVVRSTHGVNCTGS
CSWKVYVKDGLITWETQQTDYPSVGPDRPEYEPRGCPRGASFSWYTYSPTRVRHPLARGV
LVEMYRDAKRRHGGDPVAAWAELTSDPEKRRRYQSARGRGGFVRVDWDEALEIAAAAQVH
TIAEYGPDRVAGFSPIPAMSMASHAVGARYHSLIGAPMISFYDWYADLPIASPQVFGDQT
DVPESGDWWDAAYLMLWGSNVPVTRTPDAHWMAEARYRGQKVVVVSPDYADATKFADEWL
HPHPGTDGALAMAMGHVLLTEFFVRRQVPYFTDYVKRFTDLPFLVALDEHAAGRWTPGKF
VTAADLGLGRHADAGARAWMPVLIDADTDDVVVPNGTLGDRWGKGGEGRWNLDLGGTDPL
LTLHGHTGGRGDNGVEVVLPRFDEPGATVVRGVPAREIGGRLVTTVYDLLLAQYAVARPG
LAGHWPTGYDDAEQPCTPAWQERLTSVPAEAAVRAAREFARTAEQTRGRCMIVMGAGTNH
WFHSDTIYRSFLSLLILTGCQGVNGGGWAHYVGQEKVRPYTGWQQLSTAADWVRPSRQMA
GTPYWYLHTGQWRYESHAADALASPTAPGTLAGLHTADLVAQSARLGWMPSYPTFDANPL
DLGRRARESGQEPGDWIAEQLGSGAVDFACEDPDAPRNWPRVLTVWRANLIGSSAKGNEY
FLRHLLGARDGATSSEAPPEHRPRSVAWRDDAPEGKLDLLLSLDFRMTSTTLFSDLVLPA
ATWYEKHDLSSTDMHPFVHAFSPAINPPWQARTDFEIFHSLARRLSELAAGRLGTAHDLV
ATALQHDTPGETAQPGGRVTDWRDGRTPIEPGRNAPQVSLVERDYTAVADRLAAFGPLAE
EHGMTVKGVTVNPHEESRWLAARCGTAPAGPARGRPLLDTDVKFCEAILALSGTTNGRLA
AEGFDRLADRVGPGAGLAELAASVGERRVVFSDTQERPVQVGASFEWSGKEAPDRRYSPF
TVNTEHKKPWHTLTGRQHFYVDHDWMAELGEQLPVYRPPLNLAELGDAPIPTGDGRAVTV
RYLTPHAKWSIHSEYQENLLMQTLARGGPVVWMSPADADAIGAADNDWVEAVNAHGVVVA
RAIVSHRVPDGTVLMYHVQERLVNVPKSEANGRRGGVHNSLTKLLVKPTHLIGGYGQLSF
APNYYGPTGNQRDAVTTIRRRSQEVTY
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacgccgctgaccggcttctgaaggcaggtcagctgctgcggaggtcccctacc
accctcgatctgagggccgtgtaccgcacggaccagaacgtcaacgaccgtccttatcgt
gagcggtgggcgcatgacaaagtcgtgcgctccacccatggcgtcaactgcacgggatcg
tgctcgtggaaggtgtacgtcaaggacggtctgatcacctgggagacccagcagacggat
tatccgagcgtcggtcccgaccggcccgagtacgagccgcgcggctgtccgcgcggcgcc
tccttttcctggtacacctattcgcccacccgtgttcgccatccgttggcccggggcgtc
ctcgtggaaatgtaccgggacgccaaacgccggcacggcggcgaccccgtggccgcctgg
gccgagctgacctccgaccccgagaagcggcgtcgctaccagtcggcccgcggccgcggc
ggcttcgtccgcgtcgactgggacgaggcgctggagatcgccgccgccgcccaggtgcac
accatcgccgagtacggccccgaccgggtcgccgggttctccccgatccccgccatgtcc
atggcctcgcacgcggtcggcgcccgctaccactccctcatcggcgccccgatgatctcc
ttctacgactggtacgccgacctgccgatcgcctccccgcaggtcttcggcgaccagacc
gacgtaccggagtcgggcgactggtgggacgcggcctacctgatgctgtggggctccaac
gtccccgtcacccgcacccccgacgcgcactggatggcggaggcccgctaccggggccag
aaggtcgtcgtcgtctcgccggactacgcggacgccaccaagttcgccgacgagtggctg
cacccgcaccccggcaccgacggggcgctcgccatggccatgggccacgtcctgctcacc
gagttcttcgtgcgccgtcaggtgccgtacttcaccgactacgtcaagcgcttcaccgac
ctgcccttcctcgtcgccctcgacgagcacgcggcgggccgctggacgcccggcaagttc
gtcaccgccgccgacctcgggctcggccggcacgccgacgccggggcgcgggcctggatg
ccggtgctgatcgacgccgacaccgacgacgtggtcgtcccgaacggcaccctcggcgac
cggtggggcaagggcggcgaggggcgctggaacctcgacctgggcgggaccgacccgctc
ctcaccctgcacggacacacgggcggccgcggtgacaacggtgtcgaggtggtgctgccc
cgcttcgacgaacccggcgccaccgtcgtgcgcggcgtaccggcccgggagatcggcggc
cggctcgtcaccaccgtctacgacctcctcctcgcccagtacgccgtcgcccgccccggc
ctcgccggccactggcccaccggctacgacgacgccgagcagccctgcacgcccgcctgg
caggagcgcctcacctccgtcccggccgaggcggcggtccgcgcggcccgggagttcgcg
cgcaccgccgagcagacccggggccgctgcatgatcgtcatgggcgccggcaccaaccac
tggttccactccgacaccatctaccggtccttcctctcgctgctcatcctcaccggctgc
cagggcgtcaacggcggcggctgggcgcactacgtcggccaggagaaggtccgcccgtac
accggctggcagcagctgtccacggccgccgactgggtccggccctcgcggcagatggcg
ggcaccccgtactggtacctgcacaccggccagtggcggtacgagtcccacgccgccgac
gccctcgcgtcgcccaccgcccccggcaccctcgccgggctccacaccgccgacctggtc
gcccagtccgcccggctcggctggatgccgtcctacccgaccttcgacgccaacccgctc
gacctcggccgccgcgcccgcgagagcggccaggagcccggtgactggatcgcggagcaa
ctcggttcgggcgccgtggacttcgcctgcgaggaccccgacgcgccccgcaactggccg
cgcgtgctgaccgtgtggcgggccaacctgatcggctcctccgccaagggcaacgagtac
ttcctgcgccacctgctcggcgcccgcgacggcgccaccagctccgaggcaccgcccgag
caccggccgcgctccgtggcctggcgggacgacgcccccgagggcaagctcgacctgctg
ctgagcctcgacttccggatgacctccacgacgctcttctccgacctcgtgctgcccgcc
gccacctggtacgagaagcacgacctgtcctccacggacatgcaccccttcgtgcacgcc
ttcagtcccgcgatcaacccgccctggcaggcccgcaccgacttcgagatcttccactcc
ctcgcccgccgcctgagcgaactcgccgccggccgcctcggcacggcccacgacctggtc
gccaccgccctccagcacgacacccccggcgagacggctcagcccggcggccgggtcacc
gactggcgggacggccgcactcccatcgagccgggccgcaacgcccctcaggtctcgctg
gtggaacgggactacacggccgtcgccgaccggctcgccgccttcgggccgctggccgag
gagcacggcatgaccgtgaagggcgtgaccgtcaacccgcacgaggagtcgcgctggctc
gccgcccgctgcggcaccgcccccgccgggcccgcccgcggccgccccctgctcgacacc
gacgtcaagttctgcgaggcgatcctcgccctgtccggcaccaccaacggccgcctcgcc
gccgagggcttcgaccgcctcgccgaccgcgtcgggcccggcgccgggctcgccgagctc
gccgcgtcggtgggggagcggcgcgtggtcttctccgacacccaggagcgccccgtgcag
gtcggggcgagcttcgagtggtccggcaaggaggcgcccgaccggcgctactcgcccttc
accgtcaacaccgagcacaagaagccctggcacaccctcaccggccgccagcacttctac
gtcgaccacgactggatggccgagctgggcgagcagctccccgtctaccggcccccgctg
aacctggccgagctgggcgacgccccgatcccgaccggcgacggccgcgcggtgaccgtc
cgctacctcaccccgcacgccaagtggtccatccacagcgagtaccaggagaacctgctg
atgcagaccctggcccgcggcggccccgtcgtgtggatgagccccgccgacgccgacgcg
atcggcgccgccgacaacgactgggtggaggccgtcaacgcacacggcgtcgtcgtcgcc
cgcgcgatcgtctcccaccgcgtcccggacggcacggtgctcatgtaccacgtccaggaa
cgcctggtgaacgtgccgaagtcggaggcgaacggccgccgcggcggtgtccacaactcc
ctgaccaagctgctcgtcaagcccacccacctcatcggcggctacggccagctctccttc
gcccccaactactacggcccgaccggcaaccagcgcgacgccgtcaccaccatccggcgc
cgctcccaggaggtcacgtactga

DBGET integrated database retrieval system