KEGG   Streptomyces coelicolor: SCO4958Help
Entry
SCO4958           CDS       T00085                                 

Gene name
2SCK31.18, metB
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCO4958 (2SCK31.18)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO4958 (2SCK31.18)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO4958 (2SCK31.18)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     SCO4958 (2SCK31.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5393841..5395001
Genome map
AA seq 386 aa AA seqDB search
MPMSDRHISQHFETLAIHAGNTADPLTGAVVPPIYQVSTYKQDGVGGLRGGYEYSRSANP
TRTALEENLAALEGGRRGLAFASGLAAEDCLLRTLLRPGDHVVIPNDAYGGTFRLFAKVA
TRWGVEWSVADTSDAAAVRAALTPKTKAVWVETPSNPLLGITDIAQVAQVARDAGARLVV
DNTFATPYLQQPLALGADVVVHSLTKYMGGHSDVVGGALIVGDQELGEELAFHQNAMGAV
AGPFDSWLVLRGTKTLAVRMDRHSENATKVADMLSRHARVTSVLYPGLPEHPGHEVAAKQ
MKAFGGMVSFRVEGGEQAAVEVCNRAKVFTLGESLGGVESLIEHPGRMTHASAAGSALEV
PADLVRLSVGIENADDLLADLQQALG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatgagcgacaggcacatcagtcagcacttcgagacgctcgcgatccacgcgggc
aacaccgccgatcccctgacgggcgcggtcgtcccgccgatctatcaggtgtcgacctac
aagcaggacggcgtcggcggattgcgcggcggctacgagtacagccgcagcgccaacccg
acccgtaccgcgctggaggagaacctcgccgccctggagggcggccgccgcggcctcgcg
ttcgcgtccggactggcggccgaggactgcctgttgcgtacgctgctgcgccccggcgac
cacgtggtgatcccgaacgacgcgtacggcggcaccttccgcctcttcgccaaggtcgcc
acccggtggggtgtggagtggtccgtggccgacacgagcgacgccgccgccgtgcgggcc
gccctcaccccgaagaccaaggcggtgtgggtggagacgccctccaacccgctgctcggc
atcaccgacatcgcgcaggtcgcccaggtcgcccgggacgccggcgcccggctcgtcgtc
gacaacaccttcgccaccccgtacctccagcagccgctggccctcggcgccgacgtcgtc
gtgcactcgctgaccaagtacatgggcgggcactcggacgtcgtgggcggcgcgctgatc
gtgggcgaccaggagctgggcgaggagctggcgttccaccagaacgcgatgggcgcggtc
gccggacccttcgactcctggctggtgctgcgcggcaccaagaccctcgccgtgcgcatg
gaccggcacagcgagaacgcgaccaaggtcgccgacatgctctcccggcacgcgcgcgtg
acgagcgtgctgtacccggggctgcccgagcacccggggcacgaggtcgccgccaagcag
atgaaggcgttcggcggcatggtgtcgttccgcgtcgagggcggcgagcaggccgccgtc
gaggtgtgcaaccgcgcgaaggtcttcacgctcggcgagtccctcggcggcgtcgagtcg
ctgatcgagcacccgggccggatgacgcacgcctccgcggcgggctcggccctggaggtg
cccgccgacctggtgcggctgtcggtcggcatcgagaacgccgacgacctgctggccgac
ctccagcaggcgctgggctag

DBGET integrated database retrieval system