KEGG   Streptomyces coelicolor: SCO4958Help
Entry
SCO4958           CDS       T00085                                 

Gene name
2SCK31.18, metB
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO4958 (2SCK31.18)
  Energy metabolism
   00920 Sulfur metabolism
    SCO4958 (2SCK31.18)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO4958 (2SCK31.18)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO4958 (2SCK31.18)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     SCO4958 (2SCK31.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5393841..5395001
Genome map
AA seq 386 aa AA seqDB search
MPMSDRHISQHFETLAIHAGNTADPLTGAVVPPIYQVSTYKQDGVGGLRGGYEYSRSANP
TRTALEENLAALEGGRRGLAFASGLAAEDCLLRTLLRPGDHVVIPNDAYGGTFRLFAKVA
TRWGVEWSVADTSDAAAVRAALTPKTKAVWVETPSNPLLGITDIAQVAQVARDAGARLVV
DNTFATPYLQQPLALGADVVVHSLTKYMGGHSDVVGGALIVGDQELGEELAFHQNAMGAV
AGPFDSWLVLRGTKTLAVRMDRHSENATKVADMLSRHARVTSVLYPGLPEHPGHEVAAKQ
MKAFGGMVSFRVEGGEQAAVEVCNRAKVFTLGESLGGVESLIEHPGRMTHASAAGSALEV
PADLVRLSVGIENADDLLADLQQALG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatgagcgacaggcacatcagtcagcacttcgagacgctcgcgatccacgcgggc
aacaccgccgatcccctgacgggcgcggtcgtcccgccgatctatcaggtgtcgacctac
aagcaggacggcgtcggcggattgcgcggcggctacgagtacagccgcagcgccaacccg
acccgtaccgcgctggaggagaacctcgccgccctggagggcggccgccgcggcctcgcg
ttcgcgtccggactggcggccgaggactgcctgttgcgtacgctgctgcgccccggcgac
cacgtggtgatcccgaacgacgcgtacggcggcaccttccgcctcttcgccaaggtcgcc
acccggtggggtgtggagtggtccgtggccgacacgagcgacgccgccgccgtgcgggcc
gccctcaccccgaagaccaaggcggtgtgggtggagacgccctccaacccgctgctcggc
atcaccgacatcgcgcaggtcgcccaggtcgcccgggacgccggcgcccggctcgtcgtc
gacaacaccttcgccaccccgtacctccagcagccgctggccctcggcgccgacgtcgtc
gtgcactcgctgaccaagtacatgggcgggcactcggacgtcgtgggcggcgcgctgatc
gtgggcgaccaggagctgggcgaggagctggcgttccaccagaacgcgatgggcgcggtc
gccggacccttcgactcctggctggtgctgcgcggcaccaagaccctcgccgtgcgcatg
gaccggcacagcgagaacgcgaccaaggtcgccgacatgctctcccggcacgcgcgcgtg
acgagcgtgctgtacccggggctgcccgagcacccggggcacgaggtcgccgccaagcag
atgaaggcgttcggcggcatggtgtcgttccgcgtcgagggcggcgagcaggccgccgtc
gaggtgtgcaaccgcgcgaaggtcttcacgctcggcgagtccctcggcggcgtcgagtcg
ctgatcgagcacccgggccggatgacgcacgcctccgcggcgggctcggccctggaggtg
cccgccgacctggtgcggctgtcggtcggcatcgagaacgccgacgacctgctggccgac
ctccagcaggcgctgggctag

DBGET integrated database retrieval system