KEGG   Streptomyces coelicolor: SCO4962Help
Entry
SCO4962           CDS       T00085                                 

Gene name
2SCK31.22
Definition
(RefSeq) threonine dehydratase
  KO
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO4962 (2SCK31.22)
   01230 Biosynthesis of amino acids
    SCO4962 (2SCK31.22)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO4962 (2SCK31.22)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO4962 (2SCK31.22)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     SCO4962 (2SCK31.22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5396674..5397903
Genome map
AA seq 409 aa AA seqDB search
MSYSTASCVAPVTLDDVRGAQKMLSGVARVTAMEGSRHLSQLVGSPVHLKCENLQRTGSF
KLRGAYVRIAGLLPEQRAAGVVAASAGNHAQGVALASSLLGVRSTVFMPQGAPLPKISAT
RDYGAEVRLHGQVVDETLAAAQEYAERTGAVFIHPFDHPDVIAGQGTVGLEILEQCPEVR
TVVVGIGGGGLAAGIAVAVKALRPDVRIVGVQAEGAAAYPPSLAAGRPVAVQNPATMADG
IKVGRPGDVPFGIVGELVDEVRTVSEDALSTALLLCLERAKLVVEPAGASPVAALLSEPD
AFEGPVVAVLSGGNVDPVLMQGVLRHGMAAQGRYLAVRLRLTDRPGALATLLGVLSVVDA
NVLDVSHVRTHPRLGLTEAEVELHLETKGPEHCTEVGRVLREAGYTVIA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagctacagcacagcgtcctgcgtcgctcccgtcaccctcgacgacgtgcgcggagcc
cagaagatgctctcgggcgtggcgcgggtgacggccatggagggcagcaggcacctctcc
cagctggtcggctcgccggtgcacctcaagtgcgagaacctccagcggacgggctcgttc
aagctgcgcggcgcctacgtgcggatcgccgggctgctccccgagcagcgggccgcgggc
gtggtcgcggcgagcgcgggcaaccacgcgcagggcgtcgcgctggcctcgtcgctgctc
ggtgtgcgctcgacggtgttcatgccgcagggggcgccgctgcccaagatcagcgcgacc
cgggactacggcgccgaggtgcggctgcacggccaggtggtggacgagacgctggccgcc
gcgcaggagtacgcggagcggaccggcgcggtcttcatccaccccttcgaccaccccgac
gtcatcgcgggccagggcacggtcgggctggagatcctggagcagtgccccgaggtgcgg
accgtcgtcgtcggcatcggcgggggcggactggcggccgggatcgcggtcgcggtgaag
gcgctgcggccggacgtgcggatcgtcggcgtgcaggcggagggcgcggccgcctacccg
ccctcgctggccgccggacgcccggtcgccgtgcagaacccggcgacgatggccgacggg
atcaaggtggggcggcccggcgacgtgccgttcgggatcgtcggcgaactggtggacgag
gtccgcacggtctccgaggacgcgctgtcgaccgcgctgctgctgtgtctggagcgggcc
aagctggtcgtggagccggccggagcgagcccggtggcggcgctgctgagcgagccggac
gccttcgagggaccggtcgtcgcggtcctgtccggcggcaacgtggacccggtgctgatg
cagggtgtgctgcggcacggcatggccgcgcagggccgctacctggcggtccggctgcgg
ctgacggaccggcccggcgccctggccacgctgctcggggtgttgtcagtggtcgacgct
aacgtcctcgatgtgagccacgtccgaacccatccgcggctcgggctcacggaggcggag
gtcgagctgcacctggagacgaagggcccggagcactgcaccgaggtcggccgcgtgctg
cgggaagcgggatacacggtcatcgcctga

DBGET integrated database retrieval system