KEGG   Streptomyces coelicolor: SCO4971Help
Entry
SCO4971           CDS       T00085                                 

Gene name
2SCK31.31
Definition
(RefSeq) dehydrogenase
  KO
K13481  
xanthine dehydrogenase small subunit [EC:1.17.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO4971 (2SCK31.31)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SCO4971 (2SCK31.31)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5406195..5407688
Genome map
AA seq 497 aa AA seqDB search
MVTARITVNGKESPIAPAAPHTTVLDFLRERGLTGTKEGCAEGECGACSVLVARPGVNKP
TDWVPVNACLVPVAALDGQEVVTSEGLATVEAPGTPPVLHPVQEEMAVRGGSQCGYCTPG
FVCSMAAEYYRPDRCAHADPGPDATAAADGAEGGDAEHGPNGFDLHALSGNLCRCTGYRP
IRDAAFAVGTPTDEDPLARRREQDPPAPVATEYRQDDSAFLRRSTLAETLRLLRERPQAV
VVAGSTDWGVEVNIRSRRADCVVAVDRLPELRDLRVESDHVEIGAALTLTEIERRLDGSV
PLLAQLFPQFASRLIRNGATLGGNLGTGSPIGDSPPVLLALEASLVLADADGEREVPLAD
YFTGYRQSVRRPGELIRAVRVPLPLSPVTAFHKIAKRRFDDISSLAVAFALDVEGGTVRK
ARIGLGGVAATPVRALATEAALEGRPWTTGTAEAAAEVLRGEGTPMSDHRASARYRAAML
GQSLLKLYAQTTEAVPS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccgcacggatcacggtcaacggaaaagaatcgcccatcgcaccggccgccccg
cacaccacggtgctcgacttcctgcgcgagcgcggcctcaccggcaccaaggagggctgc
gcggagggcgagtgcggcgcctgttcggtcctggtggcgcgcccgggggtgaacaagccc
accgactgggtgccggtcaacgcctgcctggtgccggtcgcggcgctcgacgggcaggaa
gtcgtcacctccgagggcctcgccaccgtcgaggcgcccggcacgccgcccgtcctgcac
ccggtgcaggaggagatggcggtccgcggcggctcccagtgcggttactgcaccccgggg
ttcgtctgcagcatggcggccgagtactaccgtcccgaccgctgcgcgcacgccgacccg
ggcccggacgcgaccgccgccgccgacggcgccgaaggcggcgacgccgagcacggtccg
aacggcttcgacctgcacgcgctcagcggcaacctgtgccgctgcaccggctaccggccg
atccgcgacgcagccttcgccgtcggcacgcccaccgacgaggacccgctggcccggcgc
cgcgagcaggacccgcccgcaccggtcgccaccgaataccgccaggacgacagcgccttc
ctgcgccggagcaccctggccgagaccctgcggctgctgcgcgagcggccccaggcggtg
gtggtcgcgggcagtaccgactggggcgtcgaggtcaacatccgctcccggcgggcggat
tgcgtggtcgccgtcgaccggctgcccgaactgcgcgatctgcgggtcgagtccgaccac
gtcgagatcggggccgcgctcacgctcaccgagatcgaacgccgcctggacggcagcgtt
ccgctgctggcgcagctgttcccgcagttcgcgtcccggctcatccgcaacggcgcgacc
ctcggcggcaacctgggcaccggctcgcccatcggcgacagcccgccggtgctgctcgcg
ctggaggcgtcgctggtgctcgccgacgccgacggggagcgcgaggtcccgctggccgac
tacttcaccggctaccggcagagcgtgcgccgtcccggcgagctgatccgcgccgtacgc
gtgccgctgccgctgtctccggtcacggccttccacaagatcgccaagcggcgcttcgac
gacatctccagcctggcggtcgccttcgcgctcgacgtcgagggcggcaccgtccgcaag
gcccgcatcgggctcggcggcgtggccgccaccccggtccgcgcgctcgccaccgaggcc
gccctggagggccggccctggaccaccgggaccgccgaggccgcggccgaggtgctgcgg
ggcgagggcacgccgatgagcgaccaccgggccagcgcccgctaccgggccgcgatgctc
ggccagagcctgctgaagctgtacgcacagaccaccgaggcggtgccgtcatga

DBGET integrated database retrieval system