KEGG   Streptomyces coelicolor: SCO4979Help
Entry
SCO4979           CDS       T00085                                 

Gene name
2SCK36.02
Definition
(RefSeq) phosphoenolpyruvate carboxykinase
  KO
K01596  
phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO4979 (2SCK36.02)
   00020 Citrate cycle (TCA cycle)
    SCO4979 (2SCK36.02)
   00620 Pyruvate metabolism
    SCO4979 (2SCK36.02)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     SCO4979 (2SCK36.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5416288..5418117
Genome map
AA seq 609 aa AA seqDB search
MARDIAAPPVPTNHQELISWVNEIAELTQPDAVVWCDGSEAEYERLCGELVEKGTFRKLD
PIKRPNSYYAASDPTDVARVEDRTFICSAKEEDAGPTNHWKDPAEMRAIFTGDKGEGGLF
RGSMRGRTMYVVPFCMGPLGSPLSALGVEITDSAYVAASMRTMTRMGQPVLDELGDEGFF
VKAVHSVGAPLEPGQADVPWPCNSTKYISHFPEDREIWSYGSGYGGNALLGKKCYALRIA
SVMARDEGWLAEHMLVLKLTPPTGAPKYVAAAFPSACGKTNLAMLEPTISGWTVETIGDD
IAWMRFGEDGRLYAINPEAGFFGVAPGTGEHTNANAMKTLWGNSVFTNVALTDDGDVWWE
GMTEETPAHLTDWKGNDWTPESGTPAAHPNARFTTPAAQCPIIAPEWEDPRGVPISAILF
GGRRATAVPLVTESFDWNHGVFLGANVASEKTAAAEGKVGELRRDPFAMLPFCGYNMGDY
MGHWVDVAKDKDQSKLPKIYYVNWFRKDDAGRFVWPGFGENGRVLKWIVERLEGRADGVE
TPIGVLPTKESLDTDGLDLADADLEFLLSVDKEVWREEAALVPEHLNTFGDHTPAELWDQ
YRALVRRLG
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcgacatcgcggctccccccgtccccaccaaccaccaggaactgatctcgtgg
gtgaacgagatcgccgaactgacccagccggacgcagtggtctggtgcgacggatccgag
gccgagtacgagcgcctgtgcggggagctcgtcgagaagggcaccttccgcaaactcgac
ccgatcaagcgccccaactcgtactacgcggcctccgaccccaccgacgtcgcgcgcgtc
gaggaccggaccttcatctgctccgccaaggaggaggacgccggccccaccaaccactgg
aaggaccccgccgagatgcgggccatcttcaccggtgacaagggagaaggcgggctgttc
cgcggctccatgcgcggccggaccatgtacgtcgtgcccttctgcatgggccccctcggc
tccccgctctccgcgctcggcgtcgagatcaccgactccgcgtacgtcgccgcctccatg
cgcaccatgacccgcatgggacagccggtcctggacgagctgggcgacgagggcttcttc
gtcaaggccgtgcactccgtcggcgccccgctggagcccggccaggcggacgtcccctgg
ccctgcaacagcaccaagtacatctcgcacttccccgaggaccgcgagatctggtcctac
ggctccggctacggcggcaacgccctgctcggcaagaagtgctacgccctgcgcatcgcc
tccgtcatggcccgcgacgagggctggctcgccgagcacatgctggtgctgaagctgacg
ccgcccaccggtgcgcccaagtacgtcgccgccgccttcccgtcggcctgcggcaagacc
aacctcgccatgctggagcccacgatctccggctggaccgtggagaccatcggcgacgac
atcgcctggatgcgcttcggcgaggacggccgcctgtacgccatcaaccccgaggcgggc
ttcttcggtgtcgcgcccggcaccggtgagcacaccaacgccaacgccatgaagaccctg
tggggcaattcggtcttcaccaacgtcgccctgaccgacgacggcgacgtgtggtgggag
ggcatgaccgaggagaccccggcccacctcaccgactggaagggcaacgactggacgccc
gagtccggcaccccggccgcgcaccccaacgcccgtttcaccacgcccgccgcgcagtgc
ccgatcatcgcgccggagtgggaggaccccaggggcgtgccgatctcggcgatactcttc
ggcgggcgccgcgccaccgccgtaccgctggtcaccgagtccttcgactggaaccacggc
gtcttcctcggcgccaacgtggcctccgagaagaccgccgccgccgagggcaaggtcggc
gagctgcgccgcgaccccttcgccatgctgccgttctgcggctacaacatgggcgactac
atggggcactgggtcgacgtggccaaggacaaggaccagtccaagctgccgaagatctac
tacgtcaactggttccgcaaggacgacgcgggcaggttcgtctggcccggcttcggcgag
aacggccgcgtcctgaagtggatcgtggagcgcctggagggcagggccgacggcgtcgag
accccgatcggcgtgctgccgaccaaggagtccctcgacaccgacggactcgacctcgcc
gacgccgacctggagttcctgctcagcgtggacaaggaggtctggcgcgaggaggcggca
ctcgtccccgagcacctgaacaccttcggcgaccacacgcccgccgagctgtgggaccag
taccgggcgctggtgcggcgcctgggctga

DBGET integrated database retrieval system