KEGG   Streptomyces coelicolor: SCO4984Help
Entry
SCO4984           CDS       T00085                                 

Gene name
2SCK36.07c
Definition
(RefSeq) aminotransferase AlaT
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO4984 (2SCK36.07c)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO4984 (2SCK36.07c)
   00220 Arginine biosynthesis
    SCO4984 (2SCK36.07c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCO4984 (2SCK36.07c)
    2.6.1.66  valine---pyruvate transaminase
     SCO4984 (2SCK36.07c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class I
   SCO4984 (2SCK36.07c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5421700..5422911)
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAFGFECPPEILEDILRN
VSTAHGYGDAKGLLAARRAVVMHNQTLGIETDVEHVFIGNGVSELIVMAMQGLLDDGDEV
LVPAPDYPLWTAAVSLSGGTAVHYRCDEQSDWMPDLADVERKITDRTKALVIINPNNPTG
AVYDDAMLRGLTDIARRHNLLVCSDEIYDKILYDDATHTPTAAIAPDLLTLTFNGMSKAY
RVAGYRVGWMSISGPRAHAESYIEGLTILANMRLCANMPGQHGVVAALSGRQTINELVLP
GGRLREQRDAAHEALTSIPGVTCVKPKGALYLFPRLDPKVFKIKDDRRMVLDLLRQEKIM
VVQGTGFNWPEPDHFRVVTLPTAADLREAVDRIGNFLDGYSQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatccagtcgaccaagctcgccaacgtctgttacgagatccggggcccggtg
ctcgaggaggcgatgcggctggaggcggccgggcaccgcatcctgaagctgaacaccggc
aatccggcagccttcggcttcgagtgcccgccggagattttggaggacatcctccgcaac
gtctccacggcgcacggctacggcgacgcgaagggcctgctggcggcgcgccgggcggtc
gtcatgcacaaccagaccctcggcatcgagacggacgtcgagcacgtcttcatcggcaac
ggcgtctccgagctgatcgtgatggcgatgcagggcctgctcgacgacggcgacgaggtc
ctcgtcccggcccccgactacccgctgtggacggccgccgtctcactgtccggcggtacg
gcggtgcactaccgctgcgacgagcagtccgactggatgcccgacctcgcggacgtggag
cggaagatcaccgaccgcaccaaggccctggtgatcatcaatccgaacaacccgacgggc
gcggtctacgacgacgcgatgctgcgcggactgacggacatcgcccgccggcacaacctg
ctggtctgctcggacgagatctacgacaagatcctctacgacgacgccacccacaccccg
accgccgcgatcgcccccgacctgctcaccctcaccttcaacggcatgtcgaaggcgtac
cgggtggccggttaccgggtcggctggatgtcgatctccgggccgcgcgcgcacgccgag
tcctacatcgagggcctgacgatcctggcgaacatgcgcctgtgcgccaacatgccgggc
cagcacggcgtggtcgcggcgctcagcgggcggcagaccatcaacgagctggtgctgccg
ggcgggcggctgcgcgagcagcgcgacgccgcccacgaggcactgaccagcattcccggc
gtgacctgcgtgaagccgaagggtgcgctgtacctcttcccgcggctcgaccccaaggtc
ttcaagatcaaggacgaccggcggatggtcctggacctgctgcgccaggagaagatcatg
gtcgtccagggcaccggcttcaactggcccgagcccgaccacttccgggtggtgaccctg
ccgacggccgcggacctgcgcgaggcggtggaccggatcgggaacttcctggacgggtac
agccagccctga

DBGET integrated database retrieval system