KEGG   Streptomyces coelicolor: SCO5042Help
Entry
SCO5042           CDS       T00085                                 

Gene name
fumC
Definition
(RefSeq) fumarate hydratase
  KO
K01679  
fumarate hydratase, class II [EC:4.2.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO5042 (fumC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO5042 (fumC)
   00620 Pyruvate metabolism
    SCO5042 (fumC)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     SCO5042 (fumC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5480624..5482009)
Genome map
AA seq 461 aa AA seqDB search
MSEYRIEHDSMGEVRVPADAKWRAQTQRAVENFPVSGQRIERAHIEALARIKSAAAKVNA
ELGVLDEDVAGAIQEAAGEVAEGKWDEHFPVDVFQTGSGTSSNMNTNEVVATLATERLGR
DVHPNDHVNASQSSNDVFPSSIHIAATAAVTRDLIPALDHLAGALERKAGEFADVVKSGR
THLMDATPVTLGQEFGGYAAQVRYGIERLQASLPRLAELPLGGTAVGTGINTPPGFSAAV
IEEVARATGLPLTEARDHFEAQGARDGIVETSGQLRTIGVGLTKIANDLRWMASGPRTGL
AEISLPDLQPGSSIMPGKVNPVIPEAVLMVAAQVTGNDATVAAAGAAGNFELNVMLPVIA
KNVLESVRLLANVSRLLADRTVDGIVAHPERAREYAESSPSVVTPLNKYLGYEEAAKVAK
RALAERKTIRQTVLEGGYVERGDLTREQLDQALDVLRMTRP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaataccgcatcgagcacgactccatgggcgaggtccgcgtccccgcggacgcc
aagtggcgcgcccagacccagcgcgccgtcgagaacttccccgtctccgggcagcgcatc
gagcgcgcgcacatcgaggcgctggcgcggatcaagagcgcggcggcgaaggtcaacgcc
gagctgggagtgctcgacgaggacgtcgccggcgcgatccaggaggcggccggtgaggtg
gccgaggggaagtgggacgagcacttccccgtcgacgtgttccagaccgggtccgggacc
tcgtccaacatgaacaccaacgaggtcgtcgccaccctggcgactgaacggctcggccgc
gacgtgcatcccaacgaccacgtcaacgcctcccagtcgtccaacgacgtcttcccgtcc
tcgatccacatcgccgccaccgccgccgtcacccgcgacctgatcccggccctggaccat
ctcgccggcgccctggagcgcaaggccggggagttcgccgacgtggtgaagtccgggcgt
acgcacctcatggacgccacgcccgtcaccctgggccaggagttcggcggttacgcggcc
caggtgcggtacggcatcgagcggcttcaggcctcactgccccggctcgccgagctgccg
ctgggcggcaccgcggtcggcaccggcatcaacaccccgcccggcttctccgccgccgtc
atcgaggaggtggcccgcgcgacggggctgccgctgaccgaggcgcgcgaccacttcgag
gcgcagggcgcccgggacggcatcgtcgagaccagcgggcagctgcggaccatcggcgtc
gggctcacgaagatcgccaacgacctgcgctggatggcgtccggtccgcgcaccgggctc
gcggagatctcgctgcccgacctccagcccgggtcgtccatcatgcccggcaaggtcaac
ccggtgatccccgaggcggtcctcatggtcgccgcccaggtcaccggcaacgacgcgacg
gtcgccgcggcgggcgcggccggcaacttcgagctgaacgtgatgctgccggtcatcgcc
aagaacgtgctggagtcggtgcggctgctcgccaacgtctcccggctgctcgccgaccgc
accgtggacgggatcgtggcgcaccccgagcgggcccgcgagtacgccgagtcctcgccc
tccgtggtcacgccgctcaacaagtacctcgggtacgaggaggccgccaaggtcgccaag
agggcgctggccgagcggaagacgatccggcagaccgtgctggagggcggctacgtggaa
cgcggcgacctcacgcgggagcaactggaccaggccctggacgtgctgcggatgacccgc
ccgtga

DBGET integrated database retrieval system