KEGG   Streptomyces coelicolor: SCO5044Help
Entry
SCO5044           CDS       T00085                                 

Gene name
fumB, SCK7.17c
Definition
(RefSeq) fumarate hydratase class I
  KO
K01676  
fumarate hydratase, class I [EC:4.2.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO5044 (fumB)
   00620 Pyruvate metabolism
    SCO5044 (fumB)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     SCO5044 (fumB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5483742..5485418)
Genome map
AA seq 558 aa AA seqDB search
MGEMPEFAYTDLLPQGEDTTPYRLVTAEGVATFEADGRTFLKVEPEALRKLAEEAVHDIQ
HYLRPAHLAQLRRIIDDPEASGNDKFVALDLLKNANIAAAGVLPMCQDTGTAIVMGKRGQ
NVLTEGGDEEALSRGIYDAYKNLNLRYSQMAPLTMWEEKNTGSNLPAQIELYATDGGAYK
FLFMAKGGGSANKSFLYQETKAVLNESSMMKFLEEKIRSLGTAACPPYHLAIVVGGTSAE
YALKTAKYASAHYLDEIPAEGSELGHGFRDKELEEKVFELTQKIGIGAQFGGKYFCHDVR
VVRLPRHGASCPVAIAVSCSADRQAVAKITAEGVFLEQLETDPARFLPETTDEHLEEEGD
VVKVDLNQPMDDILAELTRHPVKTRLSLTGPLVVARDIAHAKIKERLDAGEEMPQYLKDH
PVYYAGPAKTPEGYASGSFGPTTAGRMDSYVEQFQAAGGSKVMLAKGNRSKQVTDACDAH
GGFYLGSIGGPAARLAQDCIKKVEVVEYEELGMEAVWKIEVEDFPAFIVVDDKGNDFFQD
PAPAPTFTTIPVRGPGLA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatgcctgagttcgcgtacaccgatctgctcccccagggcgaggacaccact
ccgtaccggctggtgaccgccgagggtgtcgccaccttcgaggccgacgggcggaccttc
ctcaaggtggagccggaggccctgcgcaagctggccgaggaggccgttcacgacatccag
cactacctgcgcccggcgcacctggcacagctgcgccgcatcatcgacgacccggaggcg
tccggcaacgacaagttcgtcgccctggacctgctgaagaacgcgaacatcgcggctgcg
ggcgtgctgccgatgtgccaggacaccggcacggcgatcgtcatgggcaagcgcggccag
aacgtgctcaccgagggcggtgacgaggaggccctgagccggggcatctacgacgcgtac
aagaacctgaacctgcgctactcccagatggccccgctgaccatgtgggaggagaagaac
accggctccaacctccccgcccagatcgagctgtacgcgaccgacggcggcgcctacaag
ttcctcttcatggcgaagggcggcggctcggccaacaagtccttcctctaccaggagacg
aaggccgtcctgaacgagtcctccatgatgaagttcctggaggagaagatccgctcgctc
ggcacggccgcctgcccgccgtaccacctggcgatcgtggtcggcggcacgtcggccgag
tacgcgctgaagaccgcgaagtacgcctccgcgcactacctggacgagatcccggccgag
ggctcggagctcgggcacggcttccgggacaaggagctggaggagaaggtcttcgagctg
acccagaagatcggcatcggcgctcagttcggcggcaagtacttctgccacgacgtgcgc
gtggtgcggctgccccggcacggggcgtcctgcccggtcgccatcgcggtgtcctgctcg
gcggaccggcaggcggtcgcgaagatcaccgccgagggcgtcttcctggagcagctggag
accgacccggcgcggttcctgccggagaccacggacgagcatctggaggaggagggcgac
gtcgtcaaggtcgacctcaaccagccgatggacgacatcctcgccgagctgaccaggcac
ccggtcaagacccggctgtcgctgaccggtccgctggtggtggcccgcgacatcgcgcac
gccaagatcaaggagcggctggacgcgggcgaggagatgccgcagtacctgaaggaccac
ccggtgtactacgcgggccccgcgaagacgcccgagggctacgcctccgggtccttcggt
ccgaccaccgccgggcgcatggactcctacgtcgagcagttccaggcggcgggcggctcc
aaggtgatgctggccaagggcaaccggagcaagcaggtcaccgacgcgtgcgacgcgcac
ggcggcttctacctgggctcgatcggcgggcccgcggcgcggctcgcacaggactgcatc
aagaaggtcgaggtcgtcgagtacgaggagctcggcatggaggcggtctggaagatcgag
gtcgaggacttccccgcgttcatcgtggtggacgacaagggcaacgacttcttccaggac
ccggcgcccgcgccgacgttcacgacgattccggtacgggggccgggcctggcgtaa

DBGET integrated database retrieval system