KEGG   Streptomyces coelicolor: SCO5047Help
Entry
SCO5047           CDS       T00085                                 

Gene name
glpX
Definition
(RefSeq) fructose 1,6-bisphosphatase II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00030  Pentose phosphate pathway
sco00051  Fructose and mannose metabolism
sco00680  Methane metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO5047 (glpX)
   00030 Pentose phosphate pathway
    SCO5047 (glpX)
   00051 Fructose and mannose metabolism
    SCO5047 (glpX)
  Energy metabolism
   00680 Methane metabolism
    SCO5047 (glpX)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SCO5047 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-GeneID: 1100488
NCBI-ProteinID: NP_629199
Kitasato: SCO5047
UniProt: Q9FBN2
Position
complement(5487077..5488108)
Genome map
AA seq 343 aa AA seqDB search
MTEHHLPSELDVPSEAPDRNLAMELVRVTEAAAMAAGRWVGRGDKNGADGAAVRAMRTLV
HTVSMNGVVVIGEGEKDEAPMLFNGERVGDGTGAEVDIAVDPIDGTTLTANGMTNAIAVL
AAAERGSMFDPSAVFYMDKLVTGPEAADFVDINAPVAVNIRRIAKAKRRTPEDVTVVILD
RPRHQGLIKEVRETGARIKLISDGDVAGSILALREGTGIDLLLGIGGTPEGIISACAVKC
LGGTIQGKLWPKDAEERQRAVDAGHDLDRVLTTDDLVSGDNVFFVATGITDGELLRGVRY
RSETATTDSIVMRSKSGTVRRIDSEHRLSKLRAYSAVDFDRAK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcatcatctcccgtccgagctggacgtcccctcggaggcccccgaccgcaac
ctcgccatggagctcgtgcgggtcaccgaggccgcggcgatggccgcgggccgctgggtc
gggcgcggtgacaagaacggcgccgacggtgccgcggtacgcgccatgcggaccctcgtc
cacaccgtctcgatgaacggcgtcgtcgtcatcggcgagggcgagaaggacgaggccccg
atgctcttcaacggagagcgggtcggcgacggcaccggggccgaggtcgacatcgccgtc
gacccgatcgacggcaccacgctgaccgccaacggcatgaccaacgcgatcgcggtgctg
gccgcggccgagcgcggctccatgttcgacccgtccgcggtcttctacatggacaagctg
gtcacgggccccgaggccgccgacttcgtcgacatcaacgcgcccgtcgccgtgaacatc
cgccggatcgccaaggccaagcggcgcacgcccgaggacgtcaccgtcgtcatcctcgac
cggccgcggcaccagggcctcatcaaggaggtccgggagaccggcgcccgcatcaagctg
atctccgacggcgacgtggccggctccatcctggccctgcgcgagggcaccggcatcgac
ctgctgctcggcatcggcggcacgccggagggcatcatctcggcctgcgccgtgaagtgc
ctgggcggcaccatccagggcaagctgtggcccaaggacgccgaggagcggcagcgcgcg
gtcgacgccgggcacgacctggaccgggtgctgaccaccgacgacctggtctccggggac
aacgtcttcttcgtcgccaccggcatcaccgacggcgagttgctgcgcggggtgcggtac
cgctcggagacggcgacgaccgactcgatcgtgatgcggtccaagtcggggacggtgcgg
cggatcgactccgagcaccggctgagcaagctgcgggcgtacagcgcggtggatttcgac
cgggcgaagtga

DBGET integrated database retrieval system