KEGG   Streptomyces coelicolor: SCO5047Help
Entry
SCO5047           CDS       T00085                                 

Gene name
glpX
Definition
(RefSeq) fructose 1,6-bisphosphatase II
  KO
K02446  
fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO5047 (glpX)
   00030 Pentose phosphate pathway
    SCO5047 (glpX)
   00051 Fructose and mannose metabolism
    SCO5047 (glpX)
  Energy metabolism
   00680 Methane metabolism
    SCO5047 (glpX)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SCO5047 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5487077..5488108)
Genome map
AA seq 343 aa AA seqDB search
MTEHHLPSELDVPSEAPDRNLAMELVRVTEAAAMAAGRWVGRGDKNGADGAAVRAMRTLV
HTVSMNGVVVIGEGEKDEAPMLFNGERVGDGTGAEVDIAVDPIDGTTLTANGMTNAIAVL
AAAERGSMFDPSAVFYMDKLVTGPEAADFVDINAPVAVNIRRIAKAKRRTPEDVTVVILD
RPRHQGLIKEVRETGARIKLISDGDVAGSILALREGTGIDLLLGIGGTPEGIISACAVKC
LGGTIQGKLWPKDAEERQRAVDAGHDLDRVLTTDDLVSGDNVFFVATGITDGELLRGVRY
RSETATTDSIVMRSKSGTVRRIDSEHRLSKLRAYSAVDFDRAK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcatcatctcccgtccgagctggacgtcccctcggaggcccccgaccgcaac
ctcgccatggagctcgtgcgggtcaccgaggccgcggcgatggccgcgggccgctgggtc
gggcgcggtgacaagaacggcgccgacggtgccgcggtacgcgccatgcggaccctcgtc
cacaccgtctcgatgaacggcgtcgtcgtcatcggcgagggcgagaaggacgaggccccg
atgctcttcaacggagagcgggtcggcgacggcaccggggccgaggtcgacatcgccgtc
gacccgatcgacggcaccacgctgaccgccaacggcatgaccaacgcgatcgcggtgctg
gccgcggccgagcgcggctccatgttcgacccgtccgcggtcttctacatggacaagctg
gtcacgggccccgaggccgccgacttcgtcgacatcaacgcgcccgtcgccgtgaacatc
cgccggatcgccaaggccaagcggcgcacgcccgaggacgtcaccgtcgtcatcctcgac
cggccgcggcaccagggcctcatcaaggaggtccgggagaccggcgcccgcatcaagctg
atctccgacggcgacgtggccggctccatcctggccctgcgcgagggcaccggcatcgac
ctgctgctcggcatcggcggcacgccggagggcatcatctcggcctgcgccgtgaagtgc
ctgggcggcaccatccagggcaagctgtggcccaaggacgccgaggagcggcagcgcgcg
gtcgacgccgggcacgacctggaccgggtgctgaccaccgacgacctggtctccggggac
aacgtcttcttcgtcgccaccggcatcaccgacggcgagttgctgcgcggggtgcggtac
cgctcggagacggcgacgaccgactcgatcgtgatgcggtccaagtcggggacggtgcgg
cggatcgactccgagcaccggctgagcaagctgcgggcgtacagcgcggtggatttcgac
cgggcgaagtga

DBGET integrated database retrieval system