KEGG   Streptomyces coelicolor: SCO5058Help
Entry
SCO5058           CDS       T00085                                 

Gene name
ispH
Definition
(RefSeq) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
  KO
K03527  
4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
sco  Streptomyces coelicolor
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO5058 (ispH)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     SCO5058 (ispH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5497985..5499001
Genome map
AA seq 338 aa AA seqDB search
MGAMTASPGRRVLLAAPRGYCAGVDRAVIAVEKALEQYGAPVYVRHEIVHNKYVVQTLEK
KGAIFVERTEEVPEGNIVMFSAHGVAPVVHEEAERGKLATIDATCPLVTKVHKEAVRFAN
DDYDILLIGHEGHEEVIGTSGEAPDHIQLVDGPEDVAKVEVRDPSKVVWLSQTTLSVDET
METVDALKDKFPQLISPPSDDICYATQNRQLAVKQMGAEAELVIVVGSRNSSNSKRLVEV
AKQAGSRAAYLVDFADEIDETWLDGVTTVGVTSGASVPDVLVEQVLEWLSRRGFEDVEIV
KAAEESIIFSLPKELRRDLREEAASLVAERGGSGTAGA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccatgactgcttcgcctggccgccgtgtcctgctcgccgccccccgtggctac
tgcgcgggtgtggaccgcgccgtgatcgccgtcgagaaagccctggagcagtacggggct
ccggtgtacgtccggcacgagatcgtccacaacaagtacgtcgtccagaccctggagaag
aagggcgcgatcttcgtcgagcggacggaggaggtccccgaggggaacatcgtgatgttc
tccgcgcacggcgtggcccccgtcgtccacgaggaggccgagcgcggcaagctcgccacc
atcgacgccacctgcccgctcgtcaccaaggtccacaaggaagccgtccgcttcgcgaac
gacgactacgacatcctgctcatcggtcacgagggccacgaggaggtcatcggcacctcc
ggcgaggcccccgaccacatccagctcgtcgacggccccgaggacgtcgcgaaggtcgag
gtccgcgacccgtcgaaggtggtctggctctcccagaccaccctctccgtcgacgagacg
atggagaccgtcgacgcgctcaaggacaagttcccgcagctcatctcgccgcccagcgac
gacatctgctacgccacgcagaaccgccagctcgcggtgaagcagatgggtgccgaggcc
gagctggtgatcgtcgtcggctcccgcaactcctccaactccaagcgcctggtcgaggtc
gccaagcaggccggctcccgcgcggcgtacctggtggacttcgccgacgagatcgacgag
acctggctggacggcgtcaccacggtcggcgtcacctccggcgcctccgtcccggacgtg
ctggtcgagcaggtcctggaatggctgtcgcggcgcggcttcgaggacgtggagatcgtc
aaggccgccgaggagtcgatcatcttctcgctgcccaaggaactgcgccgcgacctgcgc
gaggaggcggcgtccctggtggcggagcggggcggctccgggacggcgggggcctga

DBGET integrated database retrieval system