KEGG   Streptomyces coelicolor: SCO5076Help
Entry
SCO5076           CDS       T00085                                 

Gene name
actVA1, SCBAC28G1.02
Definition
(RefSeq) hypothetical protein
  KO
K05557  
MFS transporter, DHA2 family, integral membrane protein
Organism
sco  Streptomyces coelicolor
Brite
Transporters [BR:sco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    SCO5076 (actVA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5517894..5519495
Genome map
AA seq 533 aa AA seqDB search
MTANPGRPGGPADQGHPRRWAILGVLVLSLVGIILDNTVLNVTLRTLTDPEQGLGASHSQ
VEWVLSAYTLAFAATLFTWGVLGDRLGRRRVLLLGLGLFGLSSLAGAYAGSPEQLIAARA
CMGVSGAAVLPSTLATIAAVFPLRERPKALGIWAASVGFALGIGPVTGGILLAHFWWGSV
LLVNVPLMAGCLVAVVLVVPETRGTAGRRVDAAGLLLSIAGVVPLVYAIIEAGRSGGVTR
PAVWAAGLAGLGLLLVFLWHERRTPEPSLELGFFRMKAFSTAVAAVGFVSFAMMGFLFFS
AFYLQSVRGYTPLQAGGCTVALAVANVVCGPLSTVLVRSIGPRNVCAAGMLAVTASLCGV
TFVTQHAPVWLILVLFAALGAGVACVMPTAAVSIMNAIPREKAGVASAMNNTVRQLGGAL
GVAVLGSLMGAAYRRGIEDELAVLPPSARHQAGESLDATLLAATRLGESGLVGPARQAFL
DAMHLAAGAAAAVALVGALAVLRWLPSSVTTPTPPAGAVPGREHSDHLKVQGS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgaaccccggccgtccgggcggcccggcggaccagggccacccgcgccgctgg
gccatcctcggggtgctggtcctcagcctggtcggcatcatcctcgacaacaccgtgctc
aacgtgacgctgcgcaccctcaccgaccccgagcagggcctgggcgcctcgcacagccag
gtggaatgggtgctcagcgcctacaccctggccttcgcggcgacgctgttcacctgggga
gtgctgggcgaccgactgggccgcaggcgggtactcctgctgggcctcggcctgttcgga
ctgtcgtccctggccggggcctacgccgggtcgccggagcagctcatcgccgcccgtgcc
tgcatgggggtgagcggcgcggcggtgctgccgagcacactcgccaccatcgccgccgtc
ttcccgctgcgcgagcggcccaaggccctcgggatctgggcggcctcggtcggcttcgcc
ctcggcatcgggcccgtcaccggcgggatactgctcgcgcacttctggtggggctcggtc
ctgctggtcaacgtgcccctcatggccgggtgcctggtcgcggtggtgctggtggtgccc
gagacccggggcacggcgggcaggcgcgtcgacgcggccggactgctgctctcgatcgcg
ggtgtcgtgccgctcgtctacgcgatcatcgaggccggccggagcggcggggtcacccgg
cccgcggtctgggcagccggcctggcgggcctcggcctgctcctcgtgttcctgtggcac
gagcgccgtaccccggaaccctcgctggagctcggcttcttccggatgaaggccttctcc
accgccgtcgcggccgtcggcttcgtcagcttcgcgatgatgggcttcctcttcttcagc
gccttctacctgcagagcgtgcgcggctacacacccctgcaggccgggggatgcaccgtg
gcactggccgtcgcgaacgtggtctgcggaccgctcagcacggtcctggtgcgttcgatc
ggcccccggaacgtgtgcgcggcgggcatgctggccgtcaccgcatcgctctgcggggtc
accttcgtgacccagcacgcacccgtatggctgatcctcgtcctgttcgccgcgctgggg
gcgggcgtagcatgcgtcatgccgaccgcggccgtgtccatcatgaacgcgatcccacgc
gagaaggcgggcgtcgcctcggcgatgaacaacaccgtgcgccagctgggcggcgccctg
ggcgtcgcggtgctcggttccctcatgggcgccgcgtaccgccgcggcatcgaggacgag
ctcgccgtactgccgccctccgcgcggcaccaggccggcgagtccctggatgccaccctg
ctggccgcgactaggctgggggagagcggacttgtcggccccgcgcgccaggcattcctg
gacgccatgcacctggccgccggggccgctgccgcggtggcgctcgtgggggcccttgcc
gtgctccgctggctgccctcctccgtcacgactccgacgcccccggcaggggccgtgccc
ggccgggagcattccgatcacctcaaggtccaaggaagctga

DBGET integrated database retrieval system