KEGG   Streptomyces coelicolor: SCO5081Help
Entry
SCO5081           CDS       T00085                                 

Gene name
actVA6, SCBAC28G1.07
Definition
(RefSeq) hypothetical protein
  KO
K14632  
C-6 monooxygenase
Organism
sco  Streptomyces coelicolor
Pathway
Biosynthesis of type II polyketide products
Biosynthesis of antibiotics
Module
Dihydrokalafungin biosynthesis, octaketide => dihydrokalafungin
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SCO5081 (actVA6)
Polyketide biosynthesis proteins [BR:sco01008]
 Polyketide tailoring proteins
  Oxygenase
   SCO5081 (actVA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
5522876..5523217
Genome map
AA seq 113 aa AA seqDB search
MAEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAV
VNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgaacgatccccgggtgggcttcgtcgcggtcgtcaccttcccggtggac
ggccccgccacccagcacaagctggtggagctggccaccggcggggtgcaggagtggatc
cgcgaggtgcccggcttcctgtcggccacgtatcacgcgagcacggacgggaccgcggtc
gtcaactacgcccagtgggagagcgagcaggcctaccgggtgaacttcggcgccgacccg
cgctcggcggagctgcgggaggcgctgagctcgctgcccgggctcatggggccgccgaag
gccgtgttcatgactccgcggggggcgatcctgccgtcctga

DBGET integrated database retrieval system