KEGG   Streptomyces coelicolor: SCO5082Help
Entry
SCO5082           CDS       T00085                                 

Gene name
actII-1, SCBAC28G1.08c
Definition
(RefSeq) transcriptional regulator
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(5523183..5523962)
Genome map
AA seq 259 aa AA seqDB search
MSRSEEGRPMPEEIPVPPWRRPKKAPPRMPLTQDRIVVTALGILDAEGLDALSMRRLAQE
LKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRD
LARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRNPG
TEQGREQAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAG
AGEAADDQVRTAGSPPAES
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgaagcgaggaagggaggcccatgcccgaggagattcccgtgcctccgtggcgc
cggccgaagaaggcgccgccgcgcatgcccctgacccaggaccggatcgtcgtcacggcg
ctcggcatcctcgacgccgagggactcgacgccctgagcatgcggcggctcgcgcaggag
ctgaagaccggacacgcctcgctgtacgcgcacgtggggaaccgggacgagctgctcgac
ctcgtcttcgacatcgtgctgaccgaggtggaggtcccggaaccggaacccggccgctgg
gcggagcaggtcaaggagatgtgccggtcgctgcggaggatgttcctggcccaccgggac
ctggcacggatcgcgatcgaccgggtgccgctgggacccaacgggatggtggggatggag
cgcaccatgaacctgctgcgctccgggggcctgcacgacgaactcgccgcctacgggggc
gacctgctgtcgaccttcgtcacggcggaggccctggagcagtcgtcccgcaaccccgga
acggaacagggccgggagcaggccggcgtgttcgccgaccagctccacggctacctgaag
tcactgccggccaccagtttcccgaacctggtccacctggccggcccgatcacctcgctc
gactccgaccgccggttcgagctcggcctcgagatcatcatcgccggcctgctggccggg
gccggcgaggccgcggacgaccaggtcaggacggcaggatcgccccccgcggagtcatga

DBGET integrated database retrieval system