KEGG   Streptomyces coelicolor: SCO5083Help
Entry
SCO5083           CDS       T00085                                 

Gene name
actII-2, SCBAC28G1.09
Definition
(RefSeq) actinorhodin transporter
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5524073..5525809
Genome map
AA seq 578 aa AA seqDB search
MSSVEADEPDRATAPPSALLPEDGPGPDGTAAGPPPYARRWAALGVILGAEIMDLLDGTV
MNVAAPAVRADLGGSLSVIQWITVGYTLAFAVLLVVGGRLGDIYGRKRMFVVGAVGFTAA
SVLCSVAAGPEMLTAARFLQGGLGALMIPQGLGLIKQMFPPKETAAAFGAFGPAIGLGAV
LGPIVAGFLVDADLFGTGWRSVFLINLPIGVAVIVGAVLLLPEGKAPVRPKFDVVGMALV
TSGLTLLIFPLVQGRERGWPAWAFVLMLAGAAVLVGFVAHELRQERRGGATLIELSLLRR
SRYAAGLAVALVFFTGVSGMSLLLALHLQIGLGFSPTRAALTMTPWSVFLVVGAILTGAV
LGSKFGRKALHGGLVVLALGVLIMLLTIGDQAGGLTSWELVPGIAVAGLGMGIMIGLLFD
IALADVDKQEAGTASGVLTAVQQLGFTVGVAVLGTLFFGLLGSQATASVDDGASRARTEL
AAAGASTTEQDRLLADLRVCLRESASQQDSERTPDSCRNLQQARPAVAEATARAWRTAHT
ENFSTAMVRTLWVVIALLAVSFALAFRLPPKPREEEGF
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagttccgttgaagccgacgagccggacagggccacggccccgccgtcggcgttactg
cccgaggacggccccggaccggacggaaccgcggccggacccccgccctacgcgcgccgt
tgggccgcgctgggagtcatcctcggcgccgagatcatggacctgctcgacggcacggtc
atgaacgtggccgcgcccgccgtccgcgcggacctgggcggcagcctcagcgtcatccag
tggatcaccgtcgggtacacgctcgcgttcgccgtcctgctcgtggtgggcggccggctg
ggcgacatctacggccgcaagcgcatgttcgtcgtcggcgccgtcggcttcaccgcggcc
tccgtgctgtgctcggtggcggccggtcccgagatgctcaccgcggcacgcttccttcag
ggcgggctcggcgcgctgatgattccgcaagggctcggtctcatcaagcaaatgttcccg
cccaaggagacggcggcggcgttcggcgcgttcggacccgccatcgggctgggcgccgtg
ctcggcccgatcgtcgccgggttcctggtcgacgccgacctgttcggcacgggctggcgg
tccgtcttcctgatcaatctgccgatcggcgtggccgtgatcgtcggcgcggtcctgctg
ctgcccgagggcaaggcgcccgtgcggccgaagttcgacgtcgtcggcatggcgctggtg
acgtccgggctcaccctgctcatcttcccgctcgtccaggggcgcgaacgcggctggccc
gcctgggcgttcgtgctgatgctggccggagcggccgtgctcgtcggcttcgtcgcccac
gaactgcggcaggagaggcgcggcggcgccacgctcatcgagctcagcctgctgcgcagg
tcccgctacgccgcgggactggcggtggcactggtgttcttcaccggcgtctccggaatg
tcgctgctgctcgccctgcacctgcagatcggcctgggcttcagccccaccagggccgcg
ctgaccatgacgccctggtcggtgttcctcgtcgtcggcgcgatcctgaccggggcggtg
ctgggatcgaagttcggccgcaaggccctgcacggcgggctcgtggtgctggcgctgggc
gtgctgatcatgctgttgacgatcggcgaccaggccggcgggctgaccagctgggagctc
gtccccggtatcgccgttgccgggctcggcatgggcatcatgatcggactgctcttcgac
atcgccctggccgacgtcgacaagcaggaggccggtaccgcctccggcgtcctcaccgcg
gtccagcagctcggcttcaccgtgggcgtcgcggtgctcgggaccctgttcttcgggctg
ctcggctcacaggccacggcgagcgtcgacgacggcgcgagccgggcccgcaccgaactc
gccgccgccggggcgagcacgaccgagcaggaccggctcctggccgacctgcgggtgtgc
ctgcgggaatcggcgagtcagcaggactccgaacggacgccggacagctgccgaaacctc
cagcaggcccggccggcggtggccgaggccacggcgcgggcctggcggacggcccacacc
gagaacttcagcaccgcgatggtccgcacgctctgggtggtgatcgcactgctggcggtc
tccttcgcgctggccttccggctgccgcccaagccgcgtgaggaagagggcttctga

DBGET integrated database retrieval system