KEGG   Streptomyces coelicolor: SCO5090Help
Entry
SCO5090           CDS       T00085                                 

Gene name
actVII, SCBAC28G1.16
Definition
(RefSeq) actinorhodin polyketide synthase bifunctional cyclase/dehydratase
  KO
K05554  
aromatase [EC:4.2.1.-]
Organism
sco  Streptomyces coelicolor
Pathway
Biosynthesis of type II polyketide backbone
Biosynthesis of antibiotics
Module
Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SCO5090 (actVII)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     SCO5090 (actVII)
Lipid biosynthesis proteins [BR:sco01004]
 Polyketide synthase
  Component type
   SCO5090 (actVII)
Polyketide biosynthesis proteins [BR:sco01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     SCO5090 (actVII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5532706..5533656
Genome map
AA seq 316 aa AA seqDB search
MSRPGEHRVVHTLRTQAPARRLYELVARVEDWPAVFEPTVHVQVLERGPGTERFRIWARV
GGRVKTWTSRRTLDPDTLRVTFRQELTQPPIASMGGSWEFRGDGDGTEVVLTHDFAAVDE
AALPGLREALDANSGKELAALVALAERRQPPEELVFTFEDTLRVPSGDDAYAFIERSDLW
QERLPHVRKVTLTEEAAGTGPAETRDMTVQDMTMETVTTDGGTHTTRSIRLCVPARSIVY
KQLVPPALLSGHCGAWTFGEDTVTARHTVAIDPARVEEVLGKGATVADARTHLREVLGAN
SRATLRHAAAAAGPAS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagccggccgggagaacaccgggtggtccacaccctgaggacccaggccccggcgcgg
cggctctacgagctggtcgcacgcgtcgaagactggccggccgtcttcgaacccaccgtg
cacgtacaggtcctggagcgcggcccgggcaccgaacgcttccggatctgggcgcgcgtg
ggcggccgggtgaagacctggacgtcccgccggacgctggatcccgacaccctgagggtg
acgttccgccaggagctcacccagccgcccatcgcctcgatgggcgggagctgggagttc
cggggcgacggcgacggcaccgaagtcgtgctgacccacgacttcgccgcggtcgacgaa
gccgccctgccgggactgcgcgaggcgctggacgcgaacagcgggaaggagctggccgcg
ctggtcgcgctggcggagcgccggcagccgcccgaggagctggtcttcacgttcgaggac
acgctccgggtgccgtccggggacgacgcctacgccttcatcgagcgcagcgacctgtgg
caggaacggctgccgcacgtgcggaaggtgacactcaccgaggaggcggcgggtaccggc
cccgccgagacgcgggacatgaccgtccaggacatgaccatggagacggtgaccaccgac
ggcggtacccacaccacccgttcgatccggctctgcgtccccgcgaggagcatcgtgtac
aagcagctcgtcccgcccgccctgctctccgggcactgcggcgcctggaccttcggcgag
gacacggtcaccgcccgccacaccgtggcgatcgacccggcccgcgtggaagaggtcctg
ggcaaaggcgcgaccgtcgcggacgcccgtacccatctgcgcgaggtgctcggtgccaac
agccgggccacgctccgccacgcggcggccgccgccgggccggcgtcatga

DBGET integrated database retrieval system