KEGG   Streptomyces coelicolor: SCO5091Help
Entry
SCO5091           CDS       T00085                                 

Gene name
actIV, SCBAC28G1.17
Definition
(RefSeq) cyclase
  KO
K05555  
cyclase [EC:4.-.-.-]
Organism
sco  Streptomyces coelicolor
Pathway
Biosynthesis of type II polyketide products
Biosynthesis of antibiotics
Module
Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SCO5091 (actIV)
Enzymes [BR:sco01000]
 4. Lyases
  4.-  
   4.-.-  
    4.-.-.-  
     SCO5091 (actIV)
Polyketide biosynthesis proteins [BR:sco01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     SCO5091 (actIV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5533653..5534546
Genome map
AA seq 297 aa AA seqDB search
MTVEVREVAEGVYAYEQAPGGWCVSNAGIVVGGDGALVVDTLSTIPRARRLAEWVDKLAA
GPGRTVVNTHFHGDHAFGNQVFAPGTRIIAHEDMRSAMVTTGLALTGLWPRVDWGEIELR
PPNVTFRDRLTLHVGERQVELICVGPAHTDHDVVVWLPEERVLFAGDVVMSGVTPFALFG
SVAGTLAALDRLAELEPEVVVGGHGPVAGPEVIDANRDYLRWVQRLAADAVDRRLTPLQA
ARRADLGAFAGLLDAERLVANLHRAHEELLGGHVRDAMAIFAELVAYNGGQLPTCLA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcgaggtccgtgaggtcgccgagggtgtctacgcctacgagcaggcccccggc
ggctggtgcgtcagcaacgcgggcatcgtggtgggcggcgacggcgcgctcgtcgtcgac
acgctgtcgacgatcccgagggcgcggcggctggcggagtgggtcgacaagctcgccgcg
ggccccggccgtaccgtggtcaacacccacttccacggcgaccacgccttcggcaaccag
gtcttcgcgccggggacgcggatcatcgcgcacgaggacatgcggtccgccatggtgacg
accggcctggccctcaccgggctctggccgcgggtcgactggggcgagatcgagctgagg
ccgccgaacgtgaccttccgcgaccggttgaccctgcacgtcggcgagcgacaggtcgaa
ctgatctgcgtcggccccgcgcacaccgatcacgacgtggtggtctggctgcccgaggag
cgggtgctgttcgcgggggacgtcgtcatgtcgggcgtcactccgttcgccctcttcggt
tcggtggccggcacgctggccgcgctcgaccggctggcggagctggagcccgaggtggtc
gtcggcgggcacggcccggtggcgggacccgaggtgatcgacgccaaccgggactatctg
cgctgggtccagcgcctcgccgccgatgcggtcgaccgccggctgacaccgttgcaggcc
gcgcgccgggcggacctcggcgccttcgccgggctgctggacgcggagcgcctcgtcgcg
aacctgcaccgggcccacgaggagctgctgggcgggcacgtgcgtgacgccatggcgatc
ttcgcggagctggtcgcctacaacggtgggcagctgcccacctgcctcgcctag

DBGET integrated database retrieval system