KEGG   Streptomyces coelicolor: SCO5092Help
Entry
SCO5092           CDS       T00085                                 

Gene name
actVB, SCBAC28G1.18
Definition
(RefSeq) actinorhodin polyketide dimerase
  KO
K14631  
flavin reductase ActVB [EC:1.5.1.-]
Organism
sco  Streptomyces coelicolor
Pathway
Biosynthesis of type II polyketide products
Biosynthesis of antibiotics
Module
Dihydrokalafungin biosynthesis, octaketide => dihydrokalafungin
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SCO5092 (actVB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.-  
     SCO5092 (actVB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5534558..5535091
Genome map
AA seq 177 aa AA seqDB search
MAADQGMLRDAMARVPAGVALVTAHDRGGVPHGFTASSFVSVSMEPPLALVCLARTANSF
PVFDSCGEFAVSVLREDHTDLAMRFARKSADKFAGGEFVRTARGATVLDGAVAVVECTVH
ERYPAGDHIILLGEVQSVHVEEKGVPAVYVDRRFAALCSAAGACPSATGRGVPAHAG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgaccagggaatgctccgggacgccatggcccgggtgccggccggggtggcg
ctcgtcaccgcccatgaccgcgggggagtcccgcacggtttcaccgccagttcgttcgtg
tccgtctcgatggagccgccactggcactggtctgcctggctcgtacggccaactccttc
ccggtgttcgacagttgcggcgagttcgcggtgagcgtgctgcgcgaggaccacacggac
ctggccatgcgcttcgcgcgcaagtccgcggacaagttcgcgggcggggagttcgtccgt
accgcgcggggagcgaccgtgctcgacggagcggtcgcggtcgtcgagtgcacggtccac
gagcgctacccggcgggcgaccacatcatcctgctcggcgaggtccagtccgtgcacgtc
gaggagaagggcgtaccggcggtctacgtggaccgccggttcgccgccctgtgctcggcg
gcgggtgcctgcccgtccgccaccgggcggggcgtgcccgcgcatgccggctga

DBGET integrated database retrieval system