KEGG   Streptomyces coelicolor: SCO5136Help
Entry
SCO5136           CDS       T00085                                 

Gene name
SC9E12.21
Definition
(RefSeq) N-succinyldiaminopimelate aminotransferase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5583339..5584436
Genome map
AA seq 365 aa AA seqDB search
MSAVSDRLPTFPWDKLEPYKKTAAAHPGGIVDLSVGTPVDPVPELIQKALVDAADSPGYP
TVWGTPALRDAITGWVERRLGARDVTHRHVLPVVGSKELVAWLPTQLGLGPGDRVAFPRL
AYPTYEVGARLARAEYEAYEDPTELDPAGLKLLWLNSPSNPTGKVLSKADLTRIVAWARE
HGVLVVSDECYLELGWEADPVSVLHPDVNGGSYDGLVAVHSLSKRSNLAGYRAAFLAGDP
AVLGPLLEIRKHGGMMTPAPTQAAVVAALGDDEHVRVQRERYAARRTVLREALLGAGFRI
EHSEASLYLWATRGESCWETVAHLAERGILVAPGDFYGPAGAHFVRVALTATDDRVQAAA
DRLRS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcagtctccgaccgacttcccaccttcccctgggacaagctggagccgtacaag
aagacggccgcagcgcaccccggcggcatcgtcgacctctccgtcggcaccccggtcgac
ccggtccccgagctgatccagaaggccctggtcgacgcggcggactccccgggctacccg
accgtctggggcaccccggcgctgcgcgacgccatcaccggctgggtggagcgccgcctc
ggcgcccgcgacgtcacccaccgccacgtgctgcccgtcgtcggctccaaggaactcgtc
gcctggctcccgacccagctgggcctcggccccggcgaccgggtggccttcccgcgcctg
gcctacccgacgtacgaggtcggcgcccgcctggcccgtgcggagtacgaggcgtacgag
gacccgaccgagctggacccggcgggactgaagctcctgtggctcaactccccgtcgaac
ccgacgggcaaggtcctgtccaaggccgacctgacccggatcgtcgcctgggcccgcgag
cacggcgtcctcgtcgtctccgacgagtgctacctggagctgggctgggaggccgacccg
gtctcggtcctgcacccggacgtcaacggcggctcctacgacggcctggtcgccgtccac
tccctctccaagcgctccaacctcgcgggctaccgcgcggccttcctggccggtgacccg
gcggtcctgggcccgctcctggagatccgcaagcacggcggcatgatgaccccggcgccg
acccaggccgccgtggtggcggccctcggcgacgacgagcacgtccgcgtccagcgcgag
cgctacgccgcccgccgcacggtcctgcgcgaggccctgctgggcgccggcttccgcatc
gagcacagcgaggccagcctctacctctgggccacccgcggcgagtcgtgctgggagacg
gtcgcccacctggccgaacgcggcatcctggtggccccgggcgacttctacggcccggcg
ggcgcacacttcgtccgcgtagccctgacggcaacggacgaccgcgtccaggcagcggcg
gaccgcctgaggtcctga

DBGET integrated database retrieval system