KEGG   Streptomyces coelicolor: SCO5226Help
Entry
SCO5226           CDS       T00085                                 

Gene name
nrdL, SC7E4.23c
Definition
(RefSeq) ribonucleotide-diphosphate reductase large chain
  KO
K00525  
ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO5226 (nrdL)
   00240 Pyrimidine metabolism
    SCO5226 (nrdL)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     SCO5226 (nrdL)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SCO5226 (nrdL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(5685768..5688143)
Genome map
AA seq 791 aa AA seqDB search
MTIAPADPASATPVTATGEPDGPGAALLRTLTGLTADLPGADPGRVAAAALRGRSARADE
AELRELATEAAAGLISEDPVYSRLAARLLTIGIRAEAASQGVVTFTDSVATGHREGLIAD
RTAAFVRLHADRLDALIDQDADDRFGYFGLRTLYSRYLLRHPITRKAVETPQHFLLRVAA
GLAEDDTVRAADEVAALYGLMSRLDYLPSSPTLFNSGTRHAQMSSCYLLDSPKDELDSLY
DRLHQVARLSKHAGGIGIAYSRVRARGSLIRGTNGHSNGIVPFLKTLDASVAAVNQGGRR
KGAAAVYLETWHADVEEFLELRDNTGEDARRTHNLNLAHWIPDEFMRRVDADGTWSLFSP
ADVPELTDLWGEEFDAAYRRAEEAGLARRTLPARELYGRMMRTLAQTGNGWMTFKDTANR
TANQTATPGHVVHSSNLCTEILEVTDDGETAVCNLGSVNLGAFVDPAHGDMDWERLDATV
RTAVTFLDRVVDINFYPTEQAGRSNARWRPVGLGAMGLQDVFFQLRLPFDSPEAKALSTR
IAERIMLAAYETSADLAERNGPLPAWEKTRTARGVLHPDHYGVEPAWPERWAALRARMAT
TGLRNSLLLAIAPTATIASIAGVYECIEPQVSNLFKRETLSGEFLQVNSYLVDDLKRLGV
WDARTREALREANGSVQGFTWIPEDVRALYRTAWEIPQRGLIDMAAARTPYLDQAQSLNL
FLETPTIGKLSSMYAYAWKQGLKTTYYLRSRPATRIARAAARATTVPVQAAPDPEAVACS
LENPESCEACQ
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgcgccagccgatccggcttcagcgaccccggtgacggcgaccggggaaccc
gacggacccggtgccgccctgctgcggaccctgaccgggctgaccgccgacctccccggc
gccgaccccggccgggtggccgccgccgcactgcgcggccggtccgcccgcgccgacgag
gccgagctgcgcgagctggccaccgaggcggccgccggtctgatctccgaggacccggtc
tactcccggctggccgcccgcctgctgaccatcggcattcgcgccgaggccgcctcccag
ggcgtcgtcaccttcaccgactccgtcgccaccggccaccgcgagggcctgatcgccgac
cgcaccgccgccttcgtacggctgcacgcggaccgcctggacgcgctgatcgaccaggac
gccgacgaccgcttcggctacttcggcctgcgtacgctctacagccgctacctgctccgc
cacccgatcacccgcaaggcggtcgagacgccccagcacttcctgctgcgggtcgccgcc
ggactcgccgaggacgacacggtgcgcgcggcggacgaggtcgccgcgctgtacggcctg
atgagccgcctggactacctgccctcctcccccaccctcttcaactccggcacccggcac
gcccagatgtcgtcctgctacctcctggactcccccaaggacgagctggactccctctac
gaccgcctccaccaggtggcccgcctgtccaagcacgccggcggcatcggcatcgcctac
tcccgcgtccgcgcccggggttcgctgatccgcggcaccaacgggcactccaacggcatc
gtcccgttcctgaagacgctggacgcctcggtggcggccgtgaaccagggcggccggcgc
aagggcgcggccgcggtctacctggagacctggcacgcggacgtcgaggagttcctggag
ctgcgggacaacaccggcgaggacgcccgccgtacgcacaacctgaacctcgcgcactgg
atcccggacgagttcatgcgccgggtggacgccgacgggacctggtcgctgttctccccc
gccgacgtgccggagctgaccgacctgtggggcgaggagttcgacgccgcctaccgcagg
gcggaggaggcggggctcgcccgcaggacgctgcccgcccgtgagctgtacggccgcatg
atgcgcaccctcgcgcagaccggcaacggctggatgaccttcaaggacaccgccaaccgc
acggccaaccagaccgcgacccccggccacgtcgtccactcctccaacctctgcacggag
atcctggaggtcaccgacgacggggagaccgcggtctgcaacctgggctcggtcaacctc
ggcgcgttcgtcgacccggcgcacggggacatggactgggagcgcctggacgccaccgtc
cgcaccgcggtcaccttcctggaccgggtcgtcgacatcaacttctacccgaccgagcag
gcgggccgctccaacgcccgctggcgcccggtcggcctcggcgcgatgggcctccaggac
gtcttcttccagctccggctgcccttcgactcccccgaagcgaaggccctgtccacccgc
atcgccgagcggatcatgctcgccgcgtacgagacctccgccgacctcgccgagcgcaac
ggcccgctgccggcctgggagaagacccgtacggcccggggtgtgctgcacccggaccac
tacggcgtcgagcccgcctggccggagcgctgggccgcgctgcgcgcgcgcatggcgacg
accgggctgcgcaactccctgctcctggccatcgccccgaccgcgaccatcgcctccatc
gccggtgtctacgagtgcatcgagccgcaggtctccaacctgttcaagcgcgagacgctg
tccggcgagttcctccaggtcaactcgtacctggtggacgacctcaagcggctcggcgtg
tgggacgcgcgcacccgtgaggcgctgcgcgaggccaacggctcggtgcagggcttcacc
tggattcccgaggacgtgcgcgcgctgtaccgcaccgcctgggagatcccgcagcgcggc
ctgatcgacatggccgccgcccgcaccccgtacctcgaccaggcccagtcgctgaacctg
ttcctggagacgccgaccatcggaaagctctcctcgatgtacgcgtacgcctggaagcag
ggcctgaagaccacgtactacctgcgctcgcgcccggcgacccggatcgcccgcgccgcg
gcccgcgccaccaccgtccccgtgcaggccgccccggaccccgaagcggtcgcctgctcc
ctggaaaaccccgagtcctgcgaggcctgccagtaa

DBGET integrated database retrieval system