KEGG   Streptomyces coelicolor: SCO5236Help
Entry
SCO5236           CDS       T00085                                 

Gene name
nagB
Definition
(RefSeq) glucosamine-6-phosphate deaminase
  KO
K02564  
glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
sco  Streptomyces coelicolor
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO5236 (nagB)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     SCO5236 (nagB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5697291..5698076)
Genome map
AA seq 261 aa AA seqDB search
MEVVIVPDAKAGGELIAEAMAQLLRRKPDALLGVATGSTPLPVYEALAAKVRSGAVDTAQ
ARIAQLDEYVGLPAEHPESYRSVLRREVLEPLGIDMDAFMGPDGTAADVQAACEAYDTAL
GGSGGVDLQLLGIGTDGHIGFNEPCSSLASRTRIKTLTEQTRIDNARFFDGDIEQVPHHV
ITQGIGTILEARHVVLLATGEGKADAVAASVEGPVAAVCPASALQLHPHATVVVDEAAAS
KLKLADYFRHTYAHKPDWQGI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggaagttgtcatcgttcccgatgccaaggcgggcggcgaactcatagccgaagccatg
gcacagctgctccggcgcaagcccgacgccctgctcggggtggccaccggctcgacgccg
ctgcccgtgtacgaggcgctggcggccaaggtgcgctcgggtgccgtggacaccgcgcag
gcacggatcgcccagctcgacgaatacgtggggctgcccgccgagcaccccgagtcgtac
cgctcggtgctgcggcgcgaggtgctcgaaccgctgggcatcgacatggacgcgttcatg
ggccccgacggcacggccgcggacgtgcaggccgcgtgcgaggcctacgacacggcgctg
ggcgggagcggcggggtcgacctccagctgctgggcatcggcacggacgggcacatcggc
ttcaacgagccgtgctcctcgctcgcctcgcggacgcggatcaagaccctgaccgagcag
acccggatcgacaacgcgcgcttcttcgacggtgacatcgagcaggtgccgcaccacgtg
atcacccagggcatcggcaccatcctggaggcgcggcacgtggtgctgctcgccaccggt
gagggcaaggccgacgcggtcgccgcgagcgtcgagggtccggtcgcggccgtgtgcccg
gcctccgccctgcaactgcacccgcacgccacggtcgtcgtcgacgaggccgccgcgtcc
aagctcaagctcgccgactacttccggcacacctacgcccacaagccggactggcagggc
atctga

DBGET integrated database retrieval system