KEGG   Streptomyces coelicolor: SCO5321Help
Entry
SCO5321           CDS       T00085                                 

Gene name
SC6G9.12c
Definition
(RefSeq) polyketide hydroxylase
  KO
K14672  
putative polyketide hydroxylase
Organism
sco  Streptomyces coelicolor
Brite
Polyketide biosynthesis proteins [BR:sco01008]
 Polyketide tailoring proteins
  Oxygenase
   SCO5321 (SC6G9.12c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5791641..5793524
Genome map
AA seq 627 aa AA seqDB search
MNERADRSGGAAPGGDRTHRVPVLVVGGSLVGLSTSVFLGRLGVRHTLVERHAGTSIHPR
GRGNNVRTMEIFRVAGTEPDIRRAAATLADNHGILQAPTLAGDAGEWLFKQIDPGGGLAR
FSPSSWCLCSQNDLEPELLTHATNLGGDLRFGTELLSFEADTEGVTAIVKSRETGEHTTI
RADYLVAADGPRSPVREQLGIGQSGPGDLFHNVSITFRSRRLADVVGDRRFIVCYLTDEN
ADGALLPVDNRENWVFHAPWHPEQGETVEDFTDERCAAHIRRAIGDPDLDVEITGKAPWH
AAQRVARSYRSGRVLLAGDSAHEMSPTGAFGSNTGIQDAHNLAWKLAAVLEGWAGEALLD
TYDTERRPVAEATSARAAHRSVEHSHPGFAPPPVAGGGGPGAGTPGGAGRGTGGPGGPGG
PGGLGGPGGPGGTGGPGGPGGPGGPDGPRGAGGAPGGGPGGGPGGGGPQRGILNVALGYR
YPRGAVVGADPATPVVPEGLDLTGAPGSRAPHLWVRRGQDRLSTLDLYEDSLVLLSDAAQ
PTGWHEAAAGVAAGMRVPLKSYRVGGSPGADLNPDDEETDWARAHGVTRGGAVLVRPDGF
VAWRSPGPAPDPESMLRQVVGTVLARS
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaagagccgaccggtccggcggcgccgcccccgggggcgaccggacccaccgc
gtcccggtcctggtcgtcggcgggtccctggtgggcctgtcgacctcggtgttcctgggc
cggctgggcgtccggcacaccctggtggagcggcacgccggcacctccatccacccccgc
gggcgcggcaacaacgtccgcacgatggagatcttccgggtggccggcaccgagccggac
atccgcagggccgccgccacgctggccgacaaccacggcatcctccaggcgccgaccctg
gccggcgacgcgggggagtggctgttcaagcagatcgacccgggcggcggactggcccgc
ttcagccccagctcctggtgcctgtgcagccagaacgacctggagcccgaactcctcacg
cacgccacgaacctcggcggcgacctgcgcttcggcaccgaactgctctccttcgaggcc
gacaccgagggcgtcacggcgatcgtgaagagccgggagaccggcgagcacaccaccatc
cgcgcggactacctggtcgccgccgacggcccccgcagccccgtccgcgaacagctcggc
atcggccagagcggacccggcgacctcttccacaacgtcagcatcaccttccgctcgcgc
cgtctcgccgacgtggtgggcgaccgccggttcatcgtctgctacctgacggacgagaac
gccgacggagccctcctgcccgtcgacaaccgcgagaactgggtcttccacgccccctgg
caccccgaacagggcgaaaccgtcgaggacttcaccgacgagcgctgcgccgcccacatc
cgccgcgcgatcggcgatcccgacctcgacgtcgagatcaccggcaaggccccctggcac
gccgcccagcgcgtcgcccgcagctaccgctccggccgcgtcctgctggccggcgactcg
gcccacgagatgtcccccaccggcgccttcggctccaacaccggcatccaggacgcccac
aacctcgcctggaagctggccgcggtcctcgagggctgggcgggcgaggccctgctggac
acgtacgacacggaacggcgcccggtcgcggaggccaccagcgcccgcgccgcccatcgc
tcggtcgagcacagccacccgggcttcgcgccgccgccggtcgcggggggtggcggtccg
ggcgcgggtactcccggcggtgcgggccgtggcaccggtgggcctggcggtcctggcggg
cctggcggcctcggtggtcctggcggtcctggcggtaccggtggtcctggcggacccggt
ggtcctggcggacccgacggtcctcggggtgcgggtggtgcgcctggtggcggccccggt
ggcggtcccggcggcggcggcccgcagcgcgggatcctcaacgtcgccctcggctaccgc
tacccccggggcgcggtcgtcggcgccgacccggcgaccccggtggtcccggagggcctc
gacctcaccggagcacccggcagccgggctccccacctctgggtgcgccggggccaggac
cgcctgtccaccctggacctctacgaggactccctcgtcctgctcagcgacgccgcccag
cccaccggctggcacgaggcggccgccggggtggccgccgggatgcgggtcccgctgaag
tcgtaccgcgtgggcgggtcccccggggccgatctgaacccggacgacgaggagaccgac
tgggcgcgcgcccacggggtgacccggggcggcgcggtcctggtccgccccgacggcttc
gtggcctggcgctccccgggccccgcccccgacccggagtcgatgctgcgccaggtggtg
gggacggtgctggcccgaagctga

DBGET integrated database retrieval system